KEGG   Arabidopsis thaliana (thale cress): AT5G60940Help
Entry
AT5G60940         CDS       T00041                                 

Definition
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K14406  cleavage stimulation factor subunit 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT5G60940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT5G60940
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     AT5G60940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 836215
NCBI-ProteinID: NP_200902
MIPS: AT5G60940.1
TAIR: AT5G60940
Araport: AT5G60940
UniProt: Q8L4J2 A0A178UNF1
Position
5
AA seq 429 aa AA seqDB search
MGNSGDLEQALQDGNIFRQLNALIVAHLRHHNLSQVASAVASATMTPLNIEVPPNRLLEL
VAKGLAAENNGTLRGVSSSVLLPSSYGSITTPRTASIDFSVNHAKGSSKTIPKHESKTLS
EHKSVVRCARFSPDGMFFATGGADTSIKLFEVPKVKQMISGDTQARPLIRTFYDHAEPIN
DLDFHPRSTILISSAKDNCIKFFDFSKTTAKRAFKVFQDTHNVRSISFHPSGEFLLAGTD
HPIPHLYDVNTYQCFLPSNFPDSGVSGAINQVRYSSTGSIYITASKDGAIRLFDGVSAKC
VRSIGNAHGKSEVTSAVFTKDQRFVLSSGKDSTVKLWEIGSGRMVKEYLGAKRVKLRSQA
IFNDTEEFVISIDEASNEVVTWDARTADKVAKWPSNHNGAPRWIEHSPVESVFVTCGIDR
SIRFWKESV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggggaatagtggagatttggagcaggctctgcaagatgggaatatctttagacagctc
aatgctcttattgtagctcatctccgtcatcacaatctctcacaagttgcaagtgcggtt
gcttcagcaacaatgacaccattgaatattgaggttcctccaaaccgtcttttggagctt
gttgcaaagggtcttgcagcggagaacaatgggacattgagaggtgtttcttcatcagtc
ttgttaccttcttcttatggatcaatcactactcctcgaacagcttctatcgactttagt
gttaatcatgcgaagggctcatcaaagactatcccaaagcatgaatcaaagacgctatca
gagcacaagagcgttgttaggtgtgcaagatttagtcctgatggaatgttttttgctact
ggtggtgcagacacatctattaagctctttgaggtgccaaaagttaaacagatgatttca
ggagatactcaagctcgaccattaatacggactttttatgatcatgctgaaccgataaac
gatcttgatttccaccctcggagcacaatcctaatatctagtgccaaagacaactgtata
aagttcttcgacttctccaaaaccacggctaaacgagcattcaaagtttttcaggatacc
cataacgtgcgctctatatcttttcatccgtcaggagagtttcttcttgcaggaaccgat
catccaattccacatctgtacgatgtaaacacatatcagtgctttcttccttcaaacttc
cctgacagtggagtaagtggagccattaatcaggtgagatattcttccacgggatccatc
tacattacagcctcaaaggatggagctattcgactctttgacggggttagcgcaaagtgt
gttcgctccattggcaatgcacatggaaaatcagaggtcacaagcgcagtgttcactaaa
gatcaaaggtttgttctctcatccggtaaggattccacagttaagttatgggaaataggc
tcaggtcgaatggtaaaggaatatcttggagcaaagcgggtaaaactgcggtctcaggca
atttttaacgacactgaagagtttgtaatctccatagatgaagcaagcaatgaggtcgtt
acatgggatgctagaaccgcagataaagtggcaaagtggccttctaaccataacggtgca
ccacggtggatcgagcactcgccggttgaatcagtctttgttacttgtggaatagataga
tcaattcggttctggaaggaatccgtttag

DBGET integrated database retrieval system