KEGG   Arabidopsis thaliana (thale cress): AT5G62410Help
Entry
AT5G62410         CDS       T00041                                 

Gene name
SMC2
Definition
(RefSeq) structural maintenance of chromosomes 2
  KO
K06674  structural maintenance of chromosome 2
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G62410 (SMC2)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    AT5G62410 (SMC2)
   Condensin II
    AT5G62410 (SMC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_23 PspA_IM30 AAA_29 AAA_13 Taxilin ABC_tran BST2 TMCO5 bPH_2
Motif
Other DBs
NCBI-GeneID: 836362
NCBI-ProteinID: NP_201047
MIPS: AT5G62410.1
TAIR: AT5G62410
Araport: AT5G62410
UniProt: Q9C5Y4
Position
5
AA seq 1175 aa AA seqDB search
MHIKEICLEGFKSYATRTVVSGFDPHFNAITGLNGSGKSNILDSICFVLGITNLQQVRAA
NLQELVYKQGQAGITKATVSVTFDNSERHRSPLGYEEHPEITVTRQIVVGGRNKYLINGK
LAQPSQVQNLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMLEEAAGTRMYENKKEA
ALKTLEKKQTKVDEINKLLDHEILPALEKLRKEKSQYMQWANGNAELDRLRRFCIAFEYV
QAEKIRDNAVLGVGEMKAKLGKIDAETEKTQEEIQEFEKQIKALTQAKEASMGGEVKTLS
EKVDSLAQEMTRESSKLNNKEDTLLGEKENVEKIVHSIEDLKKSVKERAAAVKKSEEGAA
DLKQRFQELSTTLEECEKEHQGVLAGKSSGDEEKCLEDQLRDAKIAVGTAGTELKQLKTK
IEHCEKELKERKSQLMSKLEEAIEVENELGARKNDVEHVKKALESIPYNEGQMEALEKDR
GAELEVVQRLEDKVRGLSAQLANFQFTYSDPVRNFDRSKVKGVVAKLIKVKDRSSMTALE
VTAGGKLYDVVVDSEDTGKQLLQNGALRRRVTIIPLNKIQSYVVQPRVQQATARLVGKDN
AELALSLVGYSDELKNAMEYVFGSTFVCKTTDVAKEVAFNRDIRTPSVTLEGDIFQPSGL
LTGGSRKGGGDRLRKLHDLAEAESELQGHQKRLADVESQIKELQPLQMKFTDVYAQLELK
TYDLSLFLKRAEQNEHHKLGEAVKKLEEELEEAKSQIKEKELAYKNCFDAVSKLENSIKD
HDKNREGRLKDLEKNIKTIKAQMQAASKDLKSHENEKEKLVMEEEAMKQEQSSLESHLTS
LETQISTLTSEVDEQRAKVDALQKIHDESLAELKLIHAKMKECDTQISGFVTDQEKCLQK
LSDMKLERKKLENEVVRMETDHKDCSVKVDKLVEKHTWIASEKQLFGKGGTDYDFESCDP
YVAREKLEKLQSDQSGLEKRVNKKVMAMFEKAEDEYNALISKKNTIENDKSKITKVIEEL
DEKKKETLKVTWVKVNQDFGSIFSTLLPGTMAKLEPPEDGNFLDGLEVRVAFGKVWKQSL
SELSGGQRSLLALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGRMIRAHFPHSQFIV
VSLKEGMFNNANVLFRTKFVDGVSTVQRTVTKQTK
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgcatataaaggagatatgcttggagggttttaaatcatacgcgacgaggacggtggtt
tctggtttcgatccacatttcaacgcgataacgggtctgaatggttcgggaaaatccaac
atcctcgattccatctgtttcgttctgggtatcaccaatcttcagcaagttcgagctgct
aatcttcaggaactcgtctataagcaaggccaagctgggattactaaggcgactgtctcg
gttacctttgacaattccgagagacacagaagccctctcggctacgaagaacatccagag
attactgtgactagacaaattgtagttggtggaaggaacaagtatttgataaatgggaag
ctagcacaaccaagtcaagttcagaatctatttcactcggtgcagcttaatgtcaacaat
ccacactttctcatcatgcaagggcgtatcaccaaagttttgaatatgaagcctccggag
atattgtccatgcttgaagaagctgctggaacaaggatgtatgaaaacaagaaagaggct
gcattgaaaacgcttgaaaaaaagcagaccaaggttgatgagattaataagcttcttgat
catgaaatattgccggctctcgagaagttgaggaaagaaaaatcacagtacatgcagtgg
gctaatggtaacgcggagctagatcgactaaggagattctgtattgcctttgaatatgtt
caagcggagaagattagagacaatgctgttcttggagttggagaaatgaaggcgaagctc
gggaagattgacgcggaaacagaaaagacacaggaagaaatacaggaatttgagaaacag
ataaaagctctgactcaggcaaaggaagccagtatggggggagaagtaaaaactctgtca
gaaaaagtggattcactggctcaagaaatgacacgtgagtcatctaaacttaataacaag
gaggacacccttctgggagaaaaagagaatgttgaaaagattgttcacagtatagaagat
ttaaagaaatccgtaaaggagagagccgctgctgtgaagaagtctgaggaaggagcggca
gacctaaaacaaagattccaggaactctccaccacattggaagagtgtgaaaaggaacac
cagggcgtactagctggtaagagtagtggagatgaagagaaatgcttagaagatcaacta
cgggatgcaaagattgctgttggaacagctggaacagagttgaaacagctaaaaaccaaa
atagaacactgtgaaaaggagctaaaggagagaaagtctcagttaatgtcaaaacttgaa
gaagccattgaagtggagaatgaacttggagctaggaaaaatgatgtggaacatgtaaaa
aaggcacttgaatctattccttataacgagggtcaaatggaagctttggagaaggaccgt
ggagccgaacttgaagttgtgcagaggctggaagataaagtgcgtggcttatcagctcaa
ttagcaaattttcagtttacatacagcgatcctgtgaggaactttgaccgatctaaggtg
aaaggtgtggtcgcaaaactaataaaagtaaaagataggtcctcaatgacagcgttggag
gttactgctggtggcaagttgtatgatgttgttgtagactcagaagatactggaaaacag
ctccttcaaaacggtgctcttaggagaagagttacaattatacctctgaacaaaatccaa
tcttacgttgttcagcctagagtgcagcaagcgactgctagattggttggaaaggataat
gcagaactggcactttccttagtcggttatagtgatgaattaaagaatgccatggaatat
gtttttggctccacttttgtttgcaaaactactgatgtagcaaaggaagttgcttttaat
cgggatattcggactccaagtgtcacacttgaaggtgacattttccagccaagtggtctt
cttactggtgggagtcgcaagggtggaggtgatcgccttaggaaacttcatgacctggca
gaagctgaatcagaattacaaggacaccaaaaaaggttggctgacgttgaatcacagatc
aaagagcttcagcctcttcaaatgaaattcacagatgtttatgcacagttggagctgaag
acgtatgacttgtccttatttttgaagagggctgaacaaaatgagcatcacaagcttggc
gaagctgtaaaaaaacttgaagaagagcttgaagaagcgaaatcccaaatcaaagagaag
gaacttgcttataaaaattgttttgatgctgtttccaaactagagaattccatcaaagac
catgacaaaaacagagaaggaagacttaaggacttggaaaaaaatattaaaaccatcaaa
gctcaaatgcaggcagcttccaaagatttaaagagtcatgaaaatgaaaaagagaagctt
gtgatggaggaagaagcaatgaagcaagaacaatcgtccttggagagccacttaacttca
ttggaaacccaaatcagcactctgacttcggaagtagacgagcagcgagccaaggttgat
gccttacagaagattcatgatgagtctcttgccgagctcaagttgatacatgcaaagatg
aaggaatgtgatacacagataagtggttttgtcactgaccaggaaaagtgtctgcagaag
cttagtgacatgaagcttgagagaaagaaattggaaaatgaggtcgtaaggatggaaacg
gatcacaaggactgttccgtgaaagtagacaaacttgttgagaagcatacatggatagca
tctgaaaagcaactttttgggaaaggagggacagattatgattttgaatcttgtgatccg
tatgtggccagagaaaaacttgaaaagctccaatcagatcaatcaggcttggaaaaaaga
gtgaacaagaaggttatggctatgtttgagaaagcagaagatgaatacaatgctctgata
tcgaaaaaaaatactatcgagaatgacaaatcaaaaatcacgaaagtgatcgaggagctt
gatgagaagaaaaaagaaaccctgaaagttacttgggttaaagttaaccaggatttcgga
tcaatcttttcaactctactacctggcaccatggcaaaactagaacctcctgaagacggt
aacttccttgatggtcttgaggtgcgtgttgcctttggaaaagtctggaagcagtcttta
tcagaactcagtggagggcaaagatctcttcttgcgctatcactaatattggcattgctt
ctcttcaaaccggctcctctttatatattagatgaggttgatgcagctcttgatctcagt
cacacacagaacataggaagaatgataagagctcatttccctcactcgcagtttatcgtg
gtttcgctgaaagaaggaatgttcaacaatgccaatgttcttttccggacaaagttcgtt
gatggagtttcaacagtccaaaggacagtaacaaagcagaccaagtga

DBGET integrated database retrieval system