KEGG   Arabidopsis thaliana (thale cress): AT5G63310
Entry
AT5G63310         CDS       T00041                                 
Symbol
NDPK2
Name
(RefSeq) nucleoside diphosphate kinase 2
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00230  Purine metabolism
ath00240  Pyrimidine metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01232  Nucleotide metabolism
ath01240  Biosynthesis of cofactors
ath04016  MAPK signaling pathway - plant
Module
ath_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ath_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
ath_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
ath_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
ath_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AT5G63310 (NDPK2)
   00240 Pyrimidine metabolism
    AT5G63310 (NDPK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT5G63310 (NDPK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G63310 (NDPK2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AT5G63310 (NDPK2)
Membrane trafficking [BR:ath04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AT5G63310 (NDPK2)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 836451
NCBI-ProteinID: NP_568970
TAIR: AT5G63310
Position
5:complement(25371904..25373904)
AA seq 231 aa
MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRR
LRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMF
QCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEP
GTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE
NT seq 696 nt   +upstreamnt  +downstreamnt
atggtgggagcgactgtagttagtaaatggactcccctatgtgtggcttcgccgccggag
agaaactcggcaagtctcaatccacactgttctccagccagggttaattttagaacagcg
ttggccgcatttcgtcctcagttccgtcttttctctcgcaattccgcgtctcgccgccgt
cttcgcgcttccagctccgccgaatcgggaatcttccttcctcaccttgtagcttctatg
gaggacgttgaggagacttacattatggtgaaacctgatggcatacaacgaggccttgta
ggagaaatcatttctcgctttgagaaaaaggggtttaaacttattgggctcaagatgttt
cagtgcccaaaagaattggctgaggagcattataaggatcttagtgctaaatcattcttt
cctaacctgattgagtacatcacttcaggtccagttgtgtgtatggcttgggaaggtgtt
ggtgttgttgcttcagccaggaagctaatagggaaaacagatccgcttcaagctgaacct
ggtactataagaggagatcttgctgtgcaaaccggaaggaacattgtgcatggtagtgac
agccctgaaaacggcaagcgtgagattggtctgtggttcaaagagggcgagctatgcaag
tgggattcggctctagctacatggctaagggagtga

DBGET integrated database retrieval system