KEGG   Arabidopsis thaliana (thale cress): AT5G63770Help
Entry
AT5G63770         CDS       T00041                                 

Gene name
DGK2
Definition
(RefSeq) diacylglycerol kinase 2
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00561  Glycerolipid metabolism
ath00564  Glycerophospholipid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AT5G63770 (DGK2)
   00564 Glycerophospholipid metabolism
    AT5G63770 (DGK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AT5G63770 (DGK2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     AT5G63770 (DGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Motif
Other DBs
NCBI-GeneID: 836497
NCBI-ProteinID: NP_001318872
MIPS: AT5G63770.1
TAIR: AT5G63770
Araport: AT5G63770
UniProt: Q9FFN7
Position
5
AA seq 712 aa AA seqDB search
MMEVGFSLIQWLISSGADSPFIFGWLVTGSVGLLAVIYTFLKWQKKTSLNWVKAAAREKK
KVWKRLRVPLSHHQWTDDYGYGQQPSTCCVCLYSLVPGQNVSNKASLSIPVHRCAVCGVA
AHFYCSSSAAKDCKCVAQAGSDHVRHHWSERWVNMDDNADMTAFCFYCDEPCGIPFIEAS
PMWHCLWCQRLIHVKCHMIMSKESGDACDLGSLRRVILSPVHVKLNEANGVDGVLTTIKN
ELASIRGHVRRKRHRGKNGNGQSLNGKLLEDSVSDPVKTVVNGLVVKKLRRDRSIDCLKQ
VSDMPNAKGLQNGIGGHKRNKSAALNFMKKFSLVDLPPDARPLLVFINAKSGGQLGPFLH
RRLNMLLNPVQVFELGSCQGPDAGLDLCSKVKYFRVLVCGGDGTVAWVLDAIEKRNFESP
PPVAILPLGTGNDLSRVLQWGRGISVVDGQGSLRTFLQDIDHAAVTMLDRWSVKIVEEST
EKFPAREGHKFMMNYLGIGCDAKVAYEFHMMRQEKPEKFCSQFVNKLRYAKEGARDIMDR
ACADLPWQVWLEVDGKDIEIPKDSEGLIVLNIGSYMGGVDLWQNDYEHDDNFSIQCMHDK
TLEVVCVRGAWHLGKLQVGLSQARRLAQGKVIRIHVSSPFPVQIDGEPFIQQPGCLEITH
HGQVFMLRRASDEPRGHAAAIMNEVLLDAECKGVINASQKKVLLQQMALHLS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagtggggttctctcttattcagtggttgatcagttctggtgctgacagtccg
tttatatttggatggcttgtaactggatctgttggccttctggctgttatctacacattt
cttaaatggcagaaaaaaacttctttaaattgggttaaagctgctgctagagagaagaag
aaggtatggaaaagactgagagttccactttctcatcatcaatggactgatgattatggt
tatgggcaacagccatccacttgctgtgtttgtctctactcccttgttccaggtcaaaat
gtttctaataaagcatctctgagtattcccgtccaccgatgtgctgtatgcggtgtagca
gctcacttttattgctcaagctctgcagcaaaagactgcaaatgtgttgcacaggctggg
tctgaccatgtccgacatcactggtctgagcgatgggttaacatggatgataatgctgac
atgactgccttttgcttctactgtgatgaaccttgtggtattcctttcattgaagcttct
cctatgtggcactgtctttggtgccagcgcctcatacatgttaagtgtcacatgattatg
tccaaggaatctggtgatgcttgtgatcttggctctctcagaagagtaatcctctctcca
gtacatgtaaaactcaatgaagcaaatggtgtcgatggagtactgactactattaaaaac
gagttagcatctatacgagggcatgtgagaagaaagcgccacaggggaaaaaatgggaat
ggccaatctttaaatggtaagctactggaggattcagtcagcgatccagtaaaaaccgta
gttaatgggcttgtagtgaagaaactacgcagagataggagcatagattgcttaaagcaa
gtctcggacatgcctaatgccaaagggttgcaaaatggtataggcgggcacaaacgaaat
aaaagtgccgctttaaattttatgaagaagttttccttggttgatttgcccccagatgca
agaccgcttttagtctttattaacgccaaaagcggaggtcaactcggtccttttcttcac
aggagacttaatatgctattgaatccagtacaggtctttgaacttggctcttgtcaaggg
ccagacgctggtttagacctatgtagcaaagtgaagtattttagagttttggtgtgtgga
ggagatggaacagttgcatgggtgcttgatgctattgagaagcgcaatttcgaatcccct
ccacctgtcgctattcttcctttaggcacaggaaatgatttatctagagttttgcagtgg
ggaagaggtatttcagtagttgatggacaaggaagtctaagaacgtttttgcaagacatt
gatcatgctgcagttacaatgttggatcgatggagtgttaaaattgtagaagagagtaca
gaaaaatttccagcaagagaaggccataagtttatgatgaattacttaggtattggctgc
gatgcaaaagttgcatatgaatttcatatgatgcggcaagagaaacctgagaagttttgt
agtcagtttgtaaataaattacgatatgctaaagaaggtgcgagggatataatggatcga
gcatgtgccgatttaccatggcaagtttggcttgaagttgatggaaaagacattgaaatt
cctaaggattcagagggtctaatagtacttaacattggaagctatatgggtggagtagat
ctttggcaaaatgattatgaacacgatgataattttagcattcagtgtatgcacgacaag
actctagaggtggtatgtgtccgtggagcgtggcaccttggcaaactacaggtcggtctt
tctcaggctaggaggttagcacagggaaaggtaataagaatacatgtttctagtcctttt
cctgttcaaatagatggagaaccgtttatccagcaacctggctgcttggagataactcac
cacgggcaggtgtttatgctaagaagagcatcggatgaaccacgagggcatgccgcagcc
ataatgaatgaagtgttactcgatgcagaatgcaaaggagtcataaatgcatctcaaaag
aaagtactactacagcaaatggctctccatctctcgtag

DBGET integrated database retrieval system