KEGG   Arabidopsis thaliana (thale cress): AT5G64030
Entry
AT5G64030         CDS       T00041                                 
Name
(RefSeq) S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Methyltransf_29 Methyltransf_11 Methyltransf_25 Methyltransf_31 Anamorsin_N
Other DBs
NCBI-GeneID: 836524
NCBI-ProteinID: NP_201208
TAIR: AT5G64030
UniProt: Q8L7V3
Position
5:25623952..25628559
AA seq 829 aa
MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI
KKQMTPPAEEGNGQKFEDAPVETPNEDKKGDGDASLPKEDESSSKQDNQEEKKEEKTKEE
FTPSSETKSETEGGEDQKDDSKSENGGGGDLDEKKDLKDNSDEENPDTNEKQTKPETEDN
ELGEDGENQKQFESDNGEKKSIDDDKKSSDDDKENKTGNEDTETKTEKENTETNVDVQVE
QEGQSKNETSGDLSPPGAQLELLNETTAQNGSFSTQATESKNEKEAQKGSGDKLDYKWAL
CNTTAGPDYIPCLDNVQAIRSLPSTKHYEHRERHCPDSPPTCLVPLPDGYKRPIEWPKSR
EKIWYTNVPHTKLAEYKGHQNWVKVTGEYLTFPGGGTQFKHGALHYIDFIQESVPAIAWG
KRSRVVLDVGCGVASFGGFLFDRDVITMSLAPKDEHEAQVQFALERGIPAISAVMGTTRL
PFPGRVFDIVHCARCRVPWHIEGGKLLLELNRVLRPGGFFVWSATPVYQKKTEDVEIWKA
MSELIKKMCWELVSINKDTINGVGVATYRKPTSNECYKNRSEPVPPICADSDDPNASWKV
PLQACMHTAPEDKTQRGSQWPEQWPARLEKAPFWLSSSQTGVYGKAAPEDFSADYEHWKR
VVTKSYLNGLGINWASVRNVMDMRAVYGGFAAALRDLKVWVMNVVPIDSPDTLAIIYERG
LFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPEGKLIVRDDA
ETIQQVEGMVKAMKWEVRMTYSKEKEGLLSVQKSIWRPSEVETLTYAIG
NT seq 2490 nt   +upstreamnt  +downstreamnt
atggcgcaaccaaggtacactaggatagataacaggaggccctcatcaaattattgctct
acagtgacagtagttgtgtttgtggccctatgcttagtcgggatctggatgatgacatca
tcttctgttggaccggctcagaatgttgatgaggtttctctggacaacaaagatgggata
aagaaacagatgaccccacctgcagaggagggtaatggtcagaagtttgaagacgcacct
gttgaaacaccgaacgaggataaaaaaggagatggtgatgcaagcttgcccaaagaggat
gagagctcaagcaaacaagataaccaggaagagaagaaagaagagaaaactaaagaagag
tttactccatccagtgagacgaaaagtgagaccgaaggtggggaagatcaaaaagatgac
tccaagtcagaaaatggtggtggaggtgatttagatgagaaaaaagatttgaaagacaac
tcagatgaagaaaatcctgacacaaatgaaaagcaaactaaaccagaaacagaggacaat
gagttgggtgaggatggtgaaaaccaaaagcaatttgagtctgataacggtgagaaaaaa
tccattgatgatgataaaaaatccagtgatgatgataaagaaaacaagacaggcaacgaa
gatactgaaaccaagactgagaaggaaaacactgagacaaatgtggatgttcaagtagag
caagagggtcaatccaaaaacgagacctcaggtgatctttcacctcctggggcacaatta
gagctactgaatgaaactaccgcacagaatggttcattttcaacccaggcaacagagtcc
aaaaatgagaaagaagctcagaagggttctggtgataaacttgattacaaatgggcacta
tgcaatacaacagcaggacctgattacattccctgtctcgataatgtgcaagccattagg
agtcttccgagtactaaacattacgagcatcgtgagaggcattgcccagacagcccaccc
acctgccttgttcctttgcctgatggatacaagcggccaattgagtggcccaaaagtcga
gaaaagatctggtacaccaacgtccctcataccaagcttgctgagtataaggggcatcaa
aattgggttaaagttaccggtgagtatctaacttttcctggtggaggaacccaattcaag
catggtgctcttcattacatcgatttcatacaggagtctgtccctgctattgcatggggt
aaacgctctcgtgtggtcctggatgttggatgcggtgttgcaagctttggaggtttcctc
tttgacagagatgtgatcactatgtctcttgcacctaaagatgaacatgaagctcaggtg
caatttgctcttgagaggggcattcccgccatttctgcagttatgggcacgacaaggcta
cctttccctggcagagtttttgacatagttcattgtgctcgctgtagagtgccatggcac
attgaaggtggtaaacttctcctggagcttaaccgtgtattgagacccggtgggttcttt
gtgtggtctgctactcctgtttatcagaagaagaccgaagatgttgaaatttggaaagct
atgagtgaactcattaagaagatgtgttgggaactcgtatccattaacaaggacactatc
aatggagtaggtgttgctacttacagaaagccaacttcaaatgagtgctacaaaaacaga
tcagaaccggtgcctccaatttgtgcagactctgatgatccaaatgcatcttggaaagtg
ccgcttcaagcatgcatgcacaccgcgccagaagacaaaacgcaacgtggatctcagtgg
cccgaacaatggccagcgagattagagaaagcaccgttctggttatcaagttcccagact
ggagtttacggaaaagcagcaccagaggatttcagtgctgattatgagcactggaaacgc
gtagtgaccaaatcataccttaatggtttaggaatcaactgggcatctgttagaaatgtg
atggacatgagagccgtttatggaggttttgcggcagctctaagagatctgaaagtgtgg
gtcatgaatgtggttccaatagattcaccagacacacttgcaataatctatgaacgagga
ctctttggtatctaccacgattggtgcgaatctttcagtacatacccgagatcatatgat
ctccttcacgccgaccatcttttctccaaactcaaacaaaggtgcaatctaactgcggtg
atagcagaagtggatcgtgttttgagaccggaagggaaactgatagttcgagacgatgcg
gaaacaatacagcaagtggaaggcatggtgaaagcgatgaaatgggaagttcgaatgact
tattctaaggaaaaagaaggtttgctctctgttcaaaaatcaatctggcgacccagtgaa
gtggaaacactcacttacgctatcggttga

DBGET integrated database retrieval system