KEGG   Arabidopsis thaliana (thale cress): AT5G64050
Entry
AT5G64050         CDS       T00041                                 
Symbol
ERS
Name
(RefSeq) glutamate tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00860  Porphyrin metabolism
ath00970  Aminoacyl-tRNA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Module
ath_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    AT5G64050 (ERS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AT5G64050 (ERS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT5G64050 (ERS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ath03016]
    AT5G64050 (ERS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ath02048]
    AT5G64050 (ERS)
Enzymes [BR:ath01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     AT5G64050 (ERS)
Amino acid related enzymes [BR:ath01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   AT5G64050 (ERS)
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AT5G64050 (ERS)
 Prokaryotic type
   Other AARSs
    AT5G64050 (ERS)
Prokaryotic defense system [BR:ath02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    AT5G64050 (ERS)
SSDB
Motif
Pfam: tRNA-synt_1c Anticodon_2
Other DBs
NCBI-GeneID: 836526
NCBI-ProteinID: NP_201210
TAIR: AT5G64050
UniProt: Q9FEA2 A0A178UAG6
Position
5:complement(25629832..25633209)
AA seq 570 aa
MASLVYGTPWLRVRSLPELAPAFLRRRQSSLFYCSRRSFAVVACSTPVNNGGSVRVRFAP
SPTGNLHVGGARTALFNYLFARSKGGKFVLRIEDTDLERSTRESEAAVLQDLSWLGLDWD
EGPGVSGDFGPYRQSERNALYKQYAEKLLESGHVYRCFCSSEELVKMKENAKLKQLPPVY
TGKWATASDAEIEQELEKGTPFTYRFRVPKEGSLKINDLIRGEVCWNLDTLGDFVVMRSN
GQPVYNFCVTVDDATMAISHVIRAEEHLPNTLRQALIYKALKFPMPQFAHVSLILAPDRS
KLSKRHGATSVGQYREMGYLPQGMVNYLALLGWGDGTENEFFTLEDLVEKFSIERVNKSG
AIFDSTKLRWMNGQHLRALPNEKLTKLVGERWKSAGILTESEGSFVNEAVELLKDGIELV
TDSDKVLLNLLSYPLHATLASPEAKPAVEDKLHEVAASLIAAYDSGEIPSALEEGQGAWQ
KWVKAFGKSLKRKGKSLFMPLRVLLTGKLHGPEMGTSIVLIYKAGSPGIVVPQAGFVSME
ERFKILREIDWEALNKDESVPLESTATVST
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggcgagccttgtctacgggacgccgtggcttagggttagatctttaccggagcttgct
ccagcttttctcagacggcgtcaatcttctttattttactgttctcggcgaagcttcgcg
gtggttgcgtgttccactccagtcaacaatggtgggtctgtcagagttcgtttcgcgcct
tctcctactggtaatctccatgtaggtggagcaaggactgctcttttcaactacttgttc
gcgaggtctaaaggagggaaatttgtgctgagaattgaagatacagatttggagagatca
acacgtgaatctgaagcagctgttcttcaggatctctcatggcttggtcttgattgggat
gaaggtcctggggttagtggagactttggtccttatcggcaatctgaaagaaatgctttg
tataaacaatatgcagagaagcttttagagtcaggtcatgtctatcgatgcttttgctca
agtgaggaacttgtaaagatgaaggagaatgcaaagttgaaacagttgcctccagtatat
accgggaaatgggcaacagcttctgatgctgaaatagagcaagagttagaaaagggaaca
ccttttacttaccggtttcgtgtgccaaaggaaggctctttgaaaattaatgacctgatt
cgtggcgaggtctgttggaacttggatactcttggggattttgtggtaatgagaagtaat
ggccaacccgtttacaacttttgtgttacggtagatgatgctaccatggctatatcacat
gttataagggctgaagaacacttgcctaatactttgaggcaggctctaatttacaaggct
cttaagttcccgatgcctcaatttgcacatgtttctttaattttagctccggatagaagt
aaattatcaaagcgacatggggcaacttctgtaggccagtacagagagatgggatatcta
cctcagggaatggttaactatttggcactcttaggttggggagacgggactgaaaatgaa
ttcttcacactcgaggatcttgttgaaaaattctcgattgaacgtgtcaacaaaagtggc
gcgatttttgattcaacaaagttaagatggatgaatggtcaacatctgagggcacttcca
aatgagaaactaacaaaacttgttggtgagcgatggaagagcgctggtatcttaacagaa
tccgaggggagttttgtaaatgaagctgtcgagcttctcaaggatgggattgagttggtg
acagattcagacaaagtacttttgaacttgctttcatatcctctacacgctacattggct
agccctgaagctaagcctgctgtggaagacaaacttcatgaagtagcagccagcctcata
gctgcttatgacagcggagagattccaagcgctttagaagaaggacaaggtgcttggcag
aaatgggtgaaagcctttggcaaatccttgaaacgcaaaggtaaatcacttttcatgcca
ctacgagtgttgttaacgggaaaactccatggtcctgagatgggcaccagtattgttctg
atttacaaagctggaagtcctggtatagtggttcctcaagctgggtttgtgtccatggag
gaacggtttaagattcttagggagatagactgggaagctttgaacaaagatgagagtgtg
cctcttgaatctacagccacagtatcaacctga

DBGET integrated database retrieval system