KEGG   Arabidopsis thaliana (thale cress): AT5G65000
Entry
AT5G65000         CDS       T00041                                 
Name
(RefSeq) Nucleotide-sugar transporter family protein
  KO
K15272  solute carrier family 35 (UDP-sugar transporter), member A1/2/3
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT5G65000
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   AT5G65000
SSDB
Motif
Pfam: Nuc_sug_transp PUNUT CRT-like EamA DUF6442
Other DBs
NCBI-GeneID: 836624
NCBI-ProteinID: NP_569004
TAIR: AT5G65000
UniProt: Q8LES0 A0A654GE75
Position
5:complement(25964929..25967449)
AA seq 325 aa
MATANGAKSPSSMGPKVLFYSILLTLQYGAQPLISKRCIRKDVIVTSSVLTCEIVKVICA
LILMARNGSLKGLAKEWTLMGSLTASGLPAAIYALQNSLLQISYRSLDSLTFSILNQTKI
FFTAFFTFIILRQKQSILQIGALCLLIMAAVLLSVGEGSNKDSSGINADQKLFYGIIPVL
AASVLSGLASSLCQWASQVKKHSSYLMTVEMSIVGSLCLLVSTLKSPDGEAIKKYGFFHG
WTALTLVPVISNALGGILVGLVTSHAGGVRKGFVIVSALLVTALLQFAFEGKPPSSYCLV
ALPLVMSSISMYQKYPYIDKKKKKV
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgacggctaacggagcaaagagtccgtcgagtatgggccctaaggttttgttttat
tccatattgctcacacttcagtacggagcccagcctctgatctccaaacgctgcatcaga
aaggatgttattgtaacttcatctgttttgacgtgcgagattgttaaggtcatatgtgct
ctgattctcatggcaagaaatggtagtttgaagggattagcaaaagagtggacgttgatg
ggatccttgacagcatcaggacttcctgcagccatatatgcactgcagaacagtttgctg
cagatctcatacaggagtcttgattccttgacattttcaattctgaatcagacgaaaatc
tttttcacagcattctttactttcataatactaaggcagaagcaatcaattctacaaata
ggagccttgtgtctattgatcatggcagcagtccttctaagtgttggtgaaggctctaac
aaagattcaagcggcattaatgcggatcaaaagctgttttatggaattatcccggtcttg
gcagcctctgtcctgtcgggtttagcctcttctctgtgtcaatgggcttctcaggtcaag
aagcattcatcatacttaatgacggttgaaatgtctatcgttggaagcctctgtttatta
gtaagtactcttaaatctccagatggtgaagcgattaaaaaatatggcttctttcatggt
tggactgctttaacactggtcccagtaataagcaatgctcttggtgggattcttgttggc
ctagttacatcacatgccggtggtgtaagaaagggatttgtgattgtgtcggcattactt
gtgacggcgctacttcaatttgcgtttgaaggaaaaccgccatcatcgtattgcctagtt
gctcttcctcttgtgatgagtagtatctcaatgtaccagaaatacccatacattgacaag
aagaagaagaaggtgtaa

DBGET integrated database retrieval system