KEGG   Arabidopsis thaliana (thale cress): AT5G65210Help
Entry
AT5G65210         CDS       T00041                                 

Gene name
TGA1
Definition
(RefSeq) bZIP transcription factor family protein
  KO
K14431  transcription factor TGA
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT5G65210 (TGA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G65210 (TGA1)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   Plant G-box-binding factors
    AT5G65210 (TGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOG1 bZIP_1 bZIP_2
Motif
Other DBs
NCBI-GeneID: 836646
NCBI-ProteinID: NP_001032147
MIPS: AT5G65210.1
TAIR: AT5G65210
Araport: AT5G65210
UniProt: Q39237 B9DGG1 A0A384L8H7
Position
5
AA seq 368 aa AA seqDB search
MNSTSTHFVPPRRVGIYEPVHQFGMWGESFKSNISNGTMNTPNHIIIPNNQKLDNNVSED
TSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIQL
EQELDRARQQGFYVGNGIDTNSLGFSETMNPGIAAFEMEYGHWVEEQNRQICELRTVLHG
HINDIELRSLVENAMKHYFELFRMKSSAAKADVFFVMSGMWRTSAERFFLWIGGFRPSDL
LKVLLPHFDVLTDQQLLDVCNLKQSCQQAEDALTQGMEKLQHTLADCVAAGQLGEGSYIP
QVNSAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEYFQRLRALSSSW
ATRHREPT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgacatcgacacattttgtgccaccgagaagagttggtatatacgaacctgtc
catcaattcggtatgtggggggagagtttcaaaagcaatattagcaatgggactatgaac
acaccaaaccacataataataccgaataatcagaaactagacaacaacgtgtcagaggat
acttcccatggaacagcaggaactcctcacatgttcgatcaagaagcttcaacgtctaga
catcccgataagatacaaagacggcttgctcaaaaccgcgaggctgctaggaaaagtcgc
ttgcgcaagaaggcttatgttcagcaactggaaacaagcaggttgaagctaattcaatta
gagcaagaactcgatcgtgctagacaacagggattctatgtaggaaacggaatagatact
aattctctcggtttttcggaaaccatgaatccagggattgctgcatttgaaatggaatat
ggacattgggttgaagaacagaacagacagatatgtgaactaagaacagttttacacgga
cacattaacgatatcgagcttcgttcgctagtcgaaaacgccatgaaacattactttgag
cttttccggatgaaatcgtctgctgccaaagccgatgtcttcttcgtcatgtcagggatg
tggagaacttcagcagaacgattcttcttatggattggcggatttcgaccctccgatctt
ctcaaggttcttttgccacattttgatgtcttgacggatcaacaacttctagatgtatgc
aatctaaaacaatcgtgtcagcaagcagaagacgcgttgactcaaggtatggagaagctg
caacacacccttgcggactgcgttgcagcgggacaactcggtgaaggaagttacattcct
caggtgaattctgctatggatagattagaagctttggtcagtttcgtaaatcaggctgat
cacttgagacatgaaacattgcaacaaatgtatcggatattgacaacgcgacaagcggct
cgaggattattagctcttggtgagtattttcaacggcttagagccttgagctcaagttgg
gcaactcgacatcgtgaaccaacgtag

DBGET integrated database retrieval system