KEGG   Arabidopsis thaliana (thale cress): AT5G65650Help
Entry
AT5G65650         CDS       T00041                                 

Definition
(RefSeq) sugar transporter, putative (DUF1195)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1195 DUF2884
Motif
Other DBs
NCBI-GeneID: 836691
NCBI-ProteinID: NP_569015
MIPS: AT5G65650.1
TAIR: AT5G65650
Araport: AT5G65650
UniProt: Q8LFK6 A0A178URZ9
Position
5
AA seq 185 aa AA seqDB search
MKDGDSLPISTSSVAATTVTGKKETGYSALFSKGRYKFWALAAILLLAFWSMLTGTVNLR
WSAGNINHFTDDLVFPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAY
EELTSDVPDVVEAAISEIARMSIRSIVIDPPPLHSTNVRELTKTLKLADKGRATQISKPS
SRRLK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatggagattccttaccaataagcacttcttccgtcgcggcgacgacggtgacc
ggaaagaaggaaaccggttattccgctctcttctcgaaaggccggtacaagttttgggcc
ttagctgcgattctgttactcgctttctggtcaatgctcactggcacggtcaatctccgt
tggtctgccggtaacattaaccatttcaccgacgatctcgtctttcccatccacgaggat
ctcgatgttcttgaaatggaggagagggagaaagtggtgaagcacatgtgggatgtgtat
aacaatggccgtcgtatcagattacctaggttttggcaagaggccttcgaggctgcttac
gaggagcttaccagtgatgtacctgatgtggttgaggctgccatttccgagatcgctagg
atgtctattcgctccattgttatagatccgcctccgcttcattccacgaatgtacgagaa
ttgacaaagactctaaaacttgcggacaaaggaagagcaactcaaatatcaaaaccaagc
agccgtcgattgaaatag

DBGET integrated database retrieval system