KEGG   Arabidopsis thaliana (thale cress): ArthCp002Help
Entry
ArthCp002         CDS       T00041                                 

Gene name
psbA
Definition
(RefSeq) photosystem II protein D1
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00195  Photosynthesis
ath01100  Metabolic pathways
Module
ath_M00161  Photosystem II
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    ArthCp002 (psbA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ath00194]
    ArthCp002 (psbA)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     ArthCp002 (psbA)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    ArthCp002 (psbA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-GeneID: 844802
NCBI-ProteinID: NP_051039
TAIR: ATCG00020
UniProt: P83755 A0A1B1W4S7
Structure
PDB: 

Position
CP
AA seq 353 aa AA seqDB search
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF
NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTNG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaattttagagagacgcgaaagcgaaagcctatggggtcgcttctgtaactgg
ataactagcactgaaaaccgtctttacattggatggtttggtgttttgatgatccctacc
ttattgaccgcaacttctgtttttattatcgcattcattgctgctcctccagtagatatt
gatggtattcgtgaacctgtttctggatctcttctttacggaaacaatattatttccggt
gccattattcctacttctgcagctattggattgcatttttacccaatctgggaagctgca
tccgttgatgaatggctatacaacggcggtccttatgaactaattgttctacacttttta
cttggtgtagcttgttatatgggtcgtgagtgggaacttagtttccgtctgggtatgcgt
ccttggattgctgttgcatattcagctcctgttgcagctgcgactgctgttttcttgatc
tatccaattggtcagggaagtttttctgatggtatgcctctaggaatctctggtactttc
aactttatgattgtattccaggctgagcacaacattcttatgcacccatttcacatgtta
ggtgtagctggtgtattcggcggctccctttttagtgctatgcatggttccttggtaact
tctagtttgatcagggaaaccacagaaaatgaatctgctaatgaaggttacagattcggg
caagaagaagaaacttacaacattgtagctgctcacggttattttggccgattgattttc
caatatgctagtttcaacaattctcgttctttacatttcttcttagcggcttggccggta
gtaggtatttggtttactgctttaggtattagtactatggctttcaacctaaatggtttc
aatttcaaccaatcagtagttgatagtcaaggacgtgttattaatacttgggctgatatt
attaaccgtgctaaccttggtatggaagttatgcatgaacgtaatgctcacaacttccct
ctagacctagctgctgttgaggctccatctacaaatggataa

DBGET integrated database retrieval system