KEGG   Arabidopsis thaliana (thale cress): ArthCp026
Entry
ArthCp026         CDS       T00041                                 
Symbol
ndhK
Name
(RefSeq) NADH dehydrogenase subunit K
  KO
K05582  NAD(P)H-quinone oxidoreductase subunit K [EC:7.1.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
Module
ath_M00145  NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ArthCp026 (ndhK)
Enzymes [BR:ath01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     ArthCp026 (ndhK)
SSDB
Motif
Pfam: Oxidored_q6
Other DBs
NCBI-GeneID: 844761
NCBI-ProteinID: NP_051063
TAIR: ATCG00430
UniProt: P56756 A0A1B1W4U5
Structure
Position
CP:complement(49257..49934)
AA seq 225 aa
MNSIKFPILDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDR
YGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSY
STVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKIAREIYKDRIRPQQGNRCFTTNHK
FFVVRSPHIGNYDQELLYPPSSTSEISTETFFKYKSPVSSHELVN
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaattccattaagtttcccatacttgatcgaacaacaaaaaattccgttatttcaact
acgttaaatgatctttcaaattggtcaagactttccagcctatggccgcttctttatggt
accagttgttgtttcattgaatttgcctcattaataggctcccgatttgactttgatcgt
tatgggttagtaccaagatcgagtcctagacaggcggaccttattttaacagcaggtaca
gtaacaatgaaaatggctccttctttagtgcgattatatgaacaaatgcctgaaccgaag
tatgttattgctatgggagcctgtacaattacaggggggatgttcagtaccgattcttat
agtactgttcgaggagttgataagctaattcctgtagatgtctatttgccgggttgtcca
cctaaaccagaggctgttatagacgctataacaaagcttcgtaagaaaatagctagagaa
atctataaggatcgaattagacctcaacagggtaatcggtgttttactaccaatcacaag
ttttttgttgtacgcagtccgcatattggaaattatgatcaagaactactctatccacca
tcatctacttcagagatctctactgaaacattttttaaatacaaaagtccagtatcgtcc
cacgaattagtgaattag

DBGET integrated database retrieval system