KEGG   Arabidopsis thaliana (thale cress): ArthCp079
Entry
ArthCp079         CDS       T00041                                 
Symbol
ndhA
Name
(RefSeq) NADH dehydrogenase subunit 1
  KO
K05572  NAD(P)H-quinone oxidoreductase subunit 1 [EC:7.1.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
Module
ath_M00145  NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ArthCp079 (ndhA)
Enzymes [BR:ath01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     ArthCp079 (ndhA)
SSDB
Motif
Pfam: NADHdh
Other DBs
NCBI-GeneID: 844804
NCBI-ProteinID: NP_051114
TAIR: ATCG01100
UniProt: Q37165
Structure
Position
CP:complement(119847..122009)
AA seq 360 aa
MIIYATAVQTINSFVKLESLKEVYGLIWIFVPIFSLVLGIITGVLVIVWLEREISAGIQQ
RIGPEYAGPLGILQALADGTKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN
HLVLADLNIGIFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL
SISLLSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIIFLISSLAECERLPFDLPEAEEEL
IAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNISIPYISILELFQRDQIFGT
TIGIFITLAKTYLFLFVSIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQLFSL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgataatttatgcaacagcagtccaaactataaattcttttgttaaattggaatcttta
aaagaggtctatggactcatatggatatttgtccctatattttctcttgtattgggaatc
ataacaggtgtactagtaattgtgtggttagaaagagaaatatctgcagggatacaacaa
cgtattggacctgaatacgccggcccgttgggaattcttcaagctctagccgatgggaca
aaactacttttcaaagaaaatcttcgtccatctagaggaaatactcctttatttagtatt
ggaccatctatagcagttatctctattttactaagttattcagtaattccctttagcaat
caccttgttttagcggatctcaatatcggtatttttttatggattgccatctcaagtatt
gctcctattggacttcttatgtcaggatatggatcaaataataaatattcttttttaggt
ggtctgcgagctgctgcccaatcgattagttatgaaataccattaactctatgtgtttta
tcaatatctctactatctaacagtttaagtacagttgatatagttgaggcacaatcaaaa
tatggtttttggggatggaatttgtggcgtcaacctataggttttatcatttttctaatt
tcttccctagcagaatgcgagaggttaccgtttgatttaccagaagcggaagaagaatta
atagcaggttatcaaactgaatattcaggtataaaatttggtttattttacgttgcttct
tatctaaatctattaatttcctcattatttgtaacagttctatacttaggcggttggaat
atttctattccgtatatatctattctggagctatttcaaagggatcaaatttttggaaca
acaattggtatctttattacattagctaaaacttatttgtttttgttcgtttctatcgca
acaagatggactttacctaggctaagaatggatcaactattaaatcttggatggaaattt
cttttacctatttcccttggtaatctattattaaccacttctttccaactcttttcactc
taa

DBGET integrated database retrieval system