KEGG   Arabidopsis thaliana (thale cress): AT1G08090
Entry
AT1G08090         CDS       T00041                                 

Symbol
NRT2:1
Name
(RefSeq) nitrate transporter 2:1
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Module
ath_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT1G08090 (NRT2:1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G08090 (NRT2:1)
Transporters [BR:ath02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    AT1G08090 (NRT2:1)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 837327
NCBI-ProteinID: NP_172288
TAIR: AT1G08090
UniProt: O82811 A0A178WIP7
Position
1:2524023..2526322
AA seq 530 aa
MGDSTGEPGSSMHGVTGREQSFAFSVQSPIVHTDKTAKFDLPVDTEHKATVFKLFSFAKP
HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA
VCDLLGPRYGCAFLVMLSAPTVFSMSFVSDAAGFITVRFMIGFCLATFVSCQYWMSTMFN
SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGI
LVLNLGQDLPDGNRATLEKAGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELSTDN
VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGYASDFAAKYFGMRGRLWTLWIIQT
AGGLFCVWLGRANTLVTAVVAMVLFSMGAQAACGATFAIVPFVSRRALGIISGLTGAGGN
FGSGLTQLLFFSTSHFTTEQGLTWMGVMIVACTLPVTLVHFPQWGSMFLPPSTDPVKGTE
AHYYGSEWNEQEKQKNMHQGSLRFAENAKSEGGRRVRSAATPPENTPNNV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgggtgattctactggtgagccggggagctccatgcatggagtcaccggtagagaacaa
agctttgctttctcggtgcaatcaccaattgtgcataccgacaagacggccaagttcgac
cttccggtggacacagagcataaggcaacggttttcaagctcttctccttcgccaaacct
cacatgagaacgttccatctctcgtggatctctttctccacatgttttgtctcgactttc
gcagctgcaccacttgtccctatcatccgggagaatctcaacctcaccaaacaagacatt
ggaaacgccggagttgcctctgtctctgggagtatcttctctaggctcgtgatgggagcc
gtgtgtgatcttttgggtccccgttacggttgtgccttccttgtgatgttgtctgcccca
acggtgttctccatgagcttcgtgagtgacgcagcaggcttcataacggtgaggttcatg
attggtttttgcctggcgacgtttgtgtcttgtcaatactggatgagcactatgttcaac
agtcagatcattggtctggtgaatgggacagcagccggatggggaaacatgggtggcggc
ataacgcagttgctcatgcccattgtgtatgaaatcattaggcgctgcggttccacagcc
ttcacggcctggaggatcgccttctttgtacccggttggttgcacatcatcatgggaatc
ttggtgctcaatctaggtcaagatctgccagatggaaatcgagctaccttggagaaagcg
ggagaagttgccaaagacaaattcggaaagattctgtggtatgccgttacaaactacagg
acttggatcttcgttcttctctacggatactccatgggagttgagttgagcactgataat
gttatcgccgagtacttctttgacaggtttcacttgaagctccacacagcagggctcata
gcagcatgtttcggaatggccaatttctttgctcgtccagcaggaggctacgcatctgac
tttgcagccaagtacttcgggatgagagggaggttgtggacgttgtggatcatacagacg
gctggtggcctcttctgtgtgtggctcggccgcgccaacacccttgtaactgccgttgtg
gctatggtgctcttctctatgggggcacaagctgcttgcggagccacctttgcaattgtg
ccctttgtctcccggcgagctctaggcatcatctcgggtttaaccggggctggagggaac
tttggatcagggctcacacaactcctcttcttctcgacctcacacttcacaactgaacaa
gggctaacgtggatgggagtgatgatagtcgcttgcacgttacctgtgaccttagttcac
tttcctcaatggggaagcatgttcttgcctccttccacagatccagtgaaaggtacagag
gctcattattatggttctgagtggaatgagcaggagaagcagaagaacatgcatcaagga
agcctccggtttgccgagaacgccaagtcagagggtggacgccgcgtccgctctgctgct
acgccgcctgagaacacacccaacaatgtttga

DBGET integrated database retrieval system