KEGG   Arabidopsis thaliana (thale cress): AT1G08100
Entry
AT1G08100         CDS       T00041                                 

Symbol
NRT2.2
Name
(RefSeq) nitrate transporter 2.2
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Module
ath_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT1G08100 (NRT2.2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G08100 (NRT2.2)
Transporters [BR:ath02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    AT1G08100 (NRT2.2)
SSDB
Motif
Pfam: MFS_1 CHB_HEX_C_1
Other DBs
NCBI-GeneID: 837328
NCBI-ProteinID: NP_172289
TAIR: AT1G08100
UniProt: Q9LMZ9 A0A178W7F7
Position
1:complement(2527170..2529120)
AA seq 522 aa
MGSTDEPGSSMHGVTGREQSYAFSVDGSEPTNTKKKYNLPVDAEDKATVFKLFSFAKPHM
RTFHLSWISFSTCFVSTFAAAPLIPIIRENLNLTKHDIGNAGVASVSGSIFSRLVMGAVC
DLLGPRYGCAFLVMLSAPTVFSMSFVSDAAGFITVRFMIGFCLATFVSCQYWMSTMFNSQ
IIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGILV
LTLGQDLPGGNRAAMEKAGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELSTDNVI
AEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGWASDIAAKRFGMRGRLWTLWIIQTSG
GLFCVWLGRANTLVTAVVSMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGNFG
SGLTQLVFFSTSRFTTEEGLTWMGVMIVACTLPVTLIHFPQWGSMFFPPSNDSVDATEHY
YVGEYSKEEQQIGMHLKSKLFADGAKTEGGSSVHKGNATNNA
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgggttctactgatgagcccggaagttccatgcatggagttaccggtagagaacagagc
tatgctttctcggtagatggtagtgagccgaccaacacaaagaaaaagtacaatctgccg
gtggacgcggaggataaggcaacggttttcaagctcttctccttcgccaaacctcacatg
agaacgttccacctctcgtggatctctttctccacatgttttgtttcgacgttcgcagct
gcaccacttatcccgatcatcagggagaatcttaacctcaccaaacatgacattggaaac
gctggagttgcctccgtctcggggagtatcttctctaggctcgtgatgggagccgtgtgt
gatcttttgggtcctcgttacggttgtgccttccttgtgatgttgtctgccccaacggtg
ttctccatgagcttcgtgagtgacgcagcaggcttcataacggtgaggttcatgattggt
ttttgcctggcgacgtttgtgtcttgtcaatactggatgagcactatgttcaacagtcag
atcatcggtctggtgaacgggacagcagccggatggggaaacatgggtggcggcataacg
cagttgctcatgcccattgtgtatgaaatcattaggcgctgcggatcaacagcgttcacg
gcctggaggatcgccttctttgtccccggttggttgcacatcatcatgggaatcttggtg
ctcacgctaggtcaagatctgccaggtggaaacagagctgccatggagaaagcgggagaa
gttgccaaagacaaattcggaaagattctatggtacgccgttacaaattacaggacttgg
attttcgttcttctgtatggatattccatgggagttgagttaagcacagacaatgttatc
gccgagtacttctttgataggtttcacttgaagcttcacacagcggggattatagcagca
tgtttcggaatggccaatttctttgctcgtccagcaggaggctgggcatctgacattgca
gccaagcgcttcggaatgcgagggaggttgtggactttgtggatcattcagacgtccggt
ggtctcttttgtgtgtggctcggacgtgccaacaccctcgtcactgccgttgtatctatg
gtcctcttctctttaggagcacaagccgcttgcggagccacctttgctatcgtgcccttt
gtctcccggcgagctctaggcattatctcgggtttaaccggggctggagggaactttggg
tcaggactcacacagctcgtctttttctcgacttcgcgcttcacaactgaagaagggcta
acgtggatgggagtgatgatagttgcttgcacgttgcctgttaccttaatccactttcct
cagtggggaagcatgttcttccctccttccaacgattcggtcgacgctacggagcactat
tatgttggcgaatatagtaaggaggagcagcagattggcatgcatttaaaaagcaaactg
tttgctgatggagccaagaccgagggaggcagcagcgtccacaaagggaacgcaaccaac
aatgcttga

DBGET integrated database retrieval system