KEGG   Arabidopsis thaliana (thale cress): AT1G10760Help
Entry
AT1G10760         CDS       T00041                                 

Gene name
SEX1
Definition
(RefSeq) Pyruvate phosphate dikinase, PEP/pyruvate binding domain-containing protein
  KO
K08244  alpha-glucan, water dikinase [EC:2.7.9.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT1G10760 (SEX1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.4  alpha-glucan, water dikinase
     AT1G10760 (SEX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPDK_N CBM53
Motif
Other DBs
NCBI-GeneID: 837619
NCBI-ProteinID: NP_001318975
MIPS: AT1G10760.1
TAIR: AT1G10760
Araport: AT1G10760
UniProt: Q9SAC6
Position
1
AA seq 1399 aa AA seqDB search
MSNSVVHNLLNRGLIRPLNFEHQNKLNSSVYQTSTANPALGKIGRSKLYGKGLKQAGRSL
VTETGGRPLSFVPRAVLAMDPQAAEKFSLDGNIDLLVEVTSTTVREVNIQIAYTSDTLFL
HWGAILDNKENWVLPSRSPDRTQNFKNSALRTPFVKSGGNSHLKLEIDDPAIHAIEFLIF
DESRNKWYKNNGQNFHINLPTERNVKQNVSVPEDLVQIQAYLRWERKGKQMYNPEKEKEE
YEAARTELREEMMRGASVEDLRAKLLKKDNSNESPKSNGTSSSGREEKKKVSKQPERKKN
YNTDKIQRKGRDLTKLIYKHVADFVEPESKSSSEPRSLTTLEIYAKAKEEQETTPVFSKK
TFKLEGSAILVFVTKLSGKTKIHVATDFKEPVTLHWALSQKGGEWLDPPSDILPPNSLPV
RGAVDTKLTITSTDLPSPVQTFELEIEGDSYKGMPFVLNAGERWIKNNDSDFYVDFAKEE
KHVQKDYGDGKGTAKHLLDKIADLESEAQKSFMHRFNIAADLVDEAKSAGQLGFAGILVW
MRFMATRQLVWNKNYNVKPREISKAQDRLTDLLQDVYASYPEYRELLRMIMSTVGRGGEG
DVGQRIRDEILVIQRKNDCKGGIMEEWHQKLHNNTSPDDVVICQALMDYIKSDFDLSVYW
KTLNDNGITKERLLSYDRAIHSEPNFRGEQKDGLLRDLGHYMRTLKAVHSGADLESAIQN
CMGYQDDGEGFMVGVQINPVSGLPSGYPDLLRFVLEHVEEKNVEPLLEGLLEARQELRPL
LLKSHDRLKDLLFLDLALDSTVRTAIERGYEQLNDAGPEKIMYFISLVLENLALSSDDNE
DLIYCLKGWQFALDMCKSKKDHWALYAKSVLDRSRLALASKAERYLEILQPSAEYLGSCL
GVDQSAVSIFTEEIIRAGSAAALSSLVNRLDPVLRKTANLGSWQVISPVEVVGYVIVVDE
LLTVQNKTYDRPTIIVANRVRGEEEIPDGAVAVLTPDMPDVLSHVSVRARNGKICFATCF
DSGILSDLQGKDGKLLSLQPTSADVVYKEVNDSELSSPSSDNLEDAPPSISLVKKQFAGR
YAISSEEFTSDLVGAKSRNIGYLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAVNDKL
LVLKKTLDEGDQGALKEIRQTLLGLVAPPELVEELKSTMKSSDMPWPGDEGEQRWEQAWA
AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIY
AEVVKGLGETLVGAYPGRSLSFICKKNNLDSPLVLGYPSKPIGLFIRRSIIFRSDSNGED
LEGYAGAGLYDSVPMDEEDQVVLDYTTDPLITDLSFQKKVLSDIARAGDAIEKLYGTAQD
IEGVIRDGKLYVVQTRPQV
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactctgtagtgcataacttacttaaccggggtttgattcgtcctcttaacttt
gaacatcaaaacaagctcaactcctctgtgtaccaaacttcaacagcaaatccggctctt
ggcaagattggcagatcaaaactttacgggaaaggtcttaagcaggcaggacgcagtctg
gtcactgaaacaggaggaagacctctctcatttgttccacgagctgtccttgccatggat
cctcaggcagccgagaaatttagtcttgacggaaatatcgatttactggttgaagtcact
tctacaactgtaagagaagtaaatatccagatagcttatacaagtgacacattgttccta
cactggggtgcaattcttgacaacaaagaaaattgggttctaccttctcgctctccggat
agaactcaaaacttcaagaacagtgcgcttagaactccatttgtgaaatccggtggcaat
tctcaccttaaactagagatagatgatcctgccatacacgctattgagttccttatattt
gacgaaagtcggaacaaatggtataaaaataatggtcagaattttcatataaacttacca
acggaaaggaatgtgaaacaaaatgtttctgttcctgaagatcttgtacagatccaagca
tatcttagatgggaacgtaagggtaaacaaatgtacaaccctgagaaagagaaggaggag
tatgaagccgcccggacggagctacgggaggaaatgatgcgaggtgcttcagtggaagat
ctcagagcaaagctgttgaagaaagataacagtaatgaatccccaaaatctaatgggaca
tcatccagtggacgggaggaaaagaaaaaagtttccaagcaaccagagcgtaaaaaaaat
tataacactgacaagatccagcgcaagggaagggacctgactaagcttatctataagcat
gttgctgattttgttgaaccagaatccaaatcctcatctgaaccacggtccttaacaact
ctggagatatacgccaaagcaaaggaggaacaagaaaccactccagtctttagcaagaaa
acattcaagcttgaaggcagtgcgattttggtgtttgttactaaactttccggaaagacg
aaaattcatgtggcaactgattttaaagagccggttacccttcactgggctttgtctcaa
aagggtggagaatggttggacccaccttcagatatactgccaccaaactctttgccagta
cgtggtgctgttgatacaaaactgaccatcacttcaacagatcttcctagtccggttcaa
acttttgagctggaaatagaaggtgacagctacaagggcatgccgtttgtactcaatgct
ggtgaaaggtggattaaaaataatgacagtgacttttatgtggactttgctaaagaagaa
aaacatgttcagaaggattatggcgatggaaagggtacagccaagcatttactggacaaa
atcgcagatttggagagtgaggcccagaagtctttcatgcatcgattcaacattgcagca
gatcttgtggacgaggcaaaaagtgctggtcaactgggctttgcagggatcctagtctgg
atgaggtttatggctacaagacagcttgtgtggaacaaaaactataatgttaagccaagg
gagataagcaaagcgcaggatagactgactgaccttctccaggacgtttatgcaagttat
ccagagtacagagaacttttgcggatgataatgtctactgtaggtcgaggaggtgaagga
gatgtcgggcaacgaatccgtgacgaaattctagtcatccagcggaaaaatgactgcaag
ggtggaattatggaggaatggcatcagaagttgcataacaacactagtccagatgatgtt
gtcatctgtcaggcattgatggattatatcaaaagtgactttgacttaagtgtttactgg
aagaccttgaacgataatggcataaccaaagagcgactcttaagttatgatcgtgctata
cattctgaaccaaattttagaggagaacaaaaagacggtcttttgcgtgatcttggacac
tacatgaggactttaaaggctgttcattcaggggcagaccttgagtcggctatacaaaat
tgcatgggctaccaagatgacggtgaaggtttcatggttggggtgcagataaatcctgta
tcaggattgccttctggatatccagacttgcttcgtttcgtcctagaacatgttgaagaa
aagaatgtagagccacttcttgagggtttgcttgaagctcgtcaagagctaaggccactt
ctgctgaagtcccatgaccgcctcaaggatctgttattcttggacctcgctcttgattct
actgtcagaacagcgattgaaagaggatatgagcaattgaatgatgctggacctgagaaa
atcatgtacttcatcagcctagttcttgaaaatcttgccctctcttcagatgacaatgaa
gaccttatatactgcttgaagggatggcaatttgccctcgacatgtgcaagagcaaaaaa
gatcactgggctctgtatgcaaaatctgttcttgacagaagccgactagcactggcaagc
aaagctgagaggtaccttgaaattctgcaaccatcggctgaatatcttggatcttgtctt
ggagtcgatcagtcggctgttagtatatttactgaagagatcattcgagctggatctgca
gcagcattgtcgtcacttgttaaccgacttgacccagttcttaggaagactgctaacttg
ggaagttggcaggttattagtcctgtagaggtcgtcggatatgtcattgttgtggacgaa
ttgctcactgtacagaataaaacctacgatagacctacaattatagttgcaaacagagtg
agaggagaggaggaaatccctgatggtgcagttgcggtactgacacctgacatgccggat
gtactatctcatgtttctgttcgagcaagaaatggaaagatctgctttgccacatgtttt
gattctggtatcttatctgacctccaaggaaaagatggaaaactgttgagcctacaacca
acctctgcagatgtagtctataaagaggtaaacgatagtgagctttcgagtccaagttca
gacaacctggaagatgcccctccaagtatttctttggtcaagaaacagtttgcgggtaga
tatgctatatcatctgaggagttcacaagtgacttggttggtgctaaatcaagaaatatc
gggtatctgaaaggaaaagttccttcttgggttggtatcccaacttcagttgcgttgcca
tttggtgtttttgagaaggttatctccgaaaaggcgaatcaggcggtgaacgataaattg
ctagtattgaagaaaactcttgatgagggagaccaaggtgctctgaaggaaatccggcag
acactgttggggctagttgcacccccagaactggttgaagaactgaaaagtactatgaaa
agttctgacatgccatggccgggtgatgaaggtgaacagagatgggagcaagcttgggca
gccattaaaaaggtctgggcttcgaaatggaacgagagagcatacttcagcacgaggaaa
gtaaaactggatcatgactatctctgcatggctgttttggtccaagaagtcatcaatgcg
gattacgcattcgtcattcacacaactaatccatcttctggagattcatcagagatttat
gccgaggtggtcaaaggccttggggaaactcttgtaggagcatatcccggtcggtctctg
agtttcatctgcaagaaaaacaaccttgattcgcctctggtgttgggctacccaagcaaa
ccgattgggctgttcataagacgttcaatcatcttcagatctgattccaatggagaagat
cttgaaggttatgcaggtgcaggcctctacgacagtgtaccaatggacgaggaagaccaa
gtcgtgctcgattacacaacagatcctctgatcactgacttgagcttccagaaaaaggtt
ctctcagacattgcacgcgctggagatgccattgagaaactctatggaactgcacaggac
attgaaggtgtgatcagagacgggaagctctatgtcgtccagacacgaccacaagtgtga

DBGET integrated database retrieval system