KEGG   Arabidopsis thaliana (thale cress): AT1G12940
Entry
AT1G12940         CDS       T00041                                 

Symbol
NRT2.5
Name
(RefSeq) nitrate transporter2.5
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Module
ath_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT1G12940 (NRT2.5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G12940 (NRT2.5)
Transporters [BR:ath02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    AT1G12940 (NRT2.5)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 837852
NCBI-ProteinID: NP_172754
TAIR: AT1G12940
UniProt: Q9LPV5 A0A178WLN1
Position
1:4416315..4418590
AA seq 502 aa
MEVEGKGGEAGTTTTTAPRRFALPVDAENKATTFRLFSVAKPHMRAFHLSWFQFFCCFVS
TFAAPPLLPVIRENLNLTATDIGNAGIASVSGAVFARIVMGTACDLFGPRLASAALTLST
APAVYFTAGIKSPIGFIMVRFFAGFSLATFVSTQFWMSSMFSGPVVGSANGIAAGWGNLG
GGATQLIMPIVFSLIRNMGATKFTAWRIAFFIPGLFQTLSAFAVLLFGQDLPDGDYWAMH
KSGEREKDDVGKVISNGIKNYRGWITALAYGYCFGVELTIDNIIAEYFFDRFHLKLQTAG
IIAASFGLANFFARPGGGIFSDFMSRRFGMRGRLWAWWIVQTSGGVLCACLGQISSLTVS
IIVMLVFSVFVQAACGLTFGVVPFISRRSLGVVSGMTGAGGNVGAVLTQLIFFKGSTYTR
ETGITLMGVMSIACSLPICLIYFPQWGGMFCGPSSKKVTEEDYYLAEWNDEEKEKNLHIG
SQKFAETSISERGRATTTHPQT
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggaggtcgaaggcaaaggaggagaagctggaaccaccaccacaaccgcacctcggagg
ttcgcacttccggtggacgcggagaacaaagcaacaactttccgactattctcagtcgct
aaacctcacatgagagctttccatctctcatggtttcaattcttttgctgcttcgtctcc
actttcgcagctccgcctctcctccctgttatccgtgaaaatcttaacctcaccgccacc
gacatcggaaacgccggaatagcctctgtctccggcgctgttttcgctcgtatcgtcatg
ggcacggcatgtgatcttttcggtccacgtctagcctccgccgctttgacgctctccacc
gctcccgccgtctatttcaccgccgggataaagtctccgatcgggtttatcatggtgaga
ttcttcgccggattctctctcgccactttcgtctcgactcagttctggatgagctccatg
ttctctggacccgtcgtgggttcggctaacggaatcgccgccgggtggggtaacctcgga
ggaggcgcgacgcagctgatcatgcccatcgtgttctcgttgattcgtaatatgggagcc
accaagttcaccgcgtggaggatcgcttttttcatccccggtctctttcagactctctct
gctttcgccgttctcttgttcggtcaggatcttcctgatggagattattgggcgatgcat
aaatctggagagagggagaaagatgatgtggggaaagtgatatctaatggaatcaaaaac
tataggggatggataacagcattagcatatggctattgttttggagtagagcttaccatt
gacaacatcatcgcagaatatttcttcgatagattccatttaaagctccagacagcaggg
attatagcagcgagttttggactagccaattttttcgctagacctggaggaggaattttc
tctgattttatgtcgagacggtttgggatgagaggaaggttgtgggcttggtggattgtg
caaacatcaggaggtgtattatgcgcatgtcttggccagatttcttccttgacagtgtct
ataattgttatgcttgtcttctctgtattcgtccaagccgcttgtggacttacctttggc
gttgttccctttatttctagaagatctcttggggtggtatcgggaatgactggtgcggga
ggcaatgtaggcgcggtcttaacacagttgatattcttcaaaggatcgacatacacgaga
gagacgggtataactctaatgggggtaatgtcaatcgcatgttcattaccaatatgcttg
atttactttccgcaatggggaggtatgttttgtggaccctcttccaaaaaagtaactgaa
gaagactattatctcgccgaatggaacgatgaagagaaagaaaagaacttacatatcgga
agccaaaaatttgcggaaaccagcattagcgaaagaggtcgagccacaacgactcatccc
caaacttga

DBGET integrated database retrieval system