KEGG   Arabidopsis thaliana (thale cress): AT1G19800Help
Entry
AT1G19800         CDS       T00041                                 

Gene name
ABCI14
Definition
(RefSeq) trigalactosyldiacylglycerol 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: MlaE
Motif
Other DBs
NCBI-GeneID: 838568
NCBI-ProteinID: NP_001322722
MIPS: AT1G19800.1
TAIR: AT1G19800
Araport: AT1G19800
UniProt: Q8L4R0 A0A178WKD3
Position
1
AA seq 350 aa AA seqDB search
MMQTCCIHQSFCFPHRVFPRFDASIGIKPPKLCQVGFIGKTQSYGISSPIRQRRLYVNLN
ANDGHPSMSMLEEETSTENNAPSQEAELPFSKWSPSKYIWRGLSVPIIAGQVVLRILKGK
IHWRNTLQQLERTGPKSLGVCLLTSTFVGMAFTIQFVREFTRLGLNRSIGGVLALAFSRE
LSPVITSIVVAGRMGSAFAAELGTMQVSEQTDTLRVLGADPIDYLITPRVIASCLALPFL
TLMCFTVGMASSALLSDAVYGISINIIMDSAHRALRPWDIVSAMIKSQVFGAIISVISCS
WGVTTTGGAKGVGESTTSAVVMSLVGIFIADFVLSSFFFQGAGDSLKNCV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagacttgttgtatccatcaatcgttttgtttccctcatagagtctttccacgg
tttgatgcttcgattggtattaagcccccaaagctttgtcaagttggtttcattggaaag
actcaatcttatgggatttcaagtccgatacggcaaagaagattatatgtgaatttgaat
gctaatgatggtcacccatccatgtctatgttggaagaagaaacctctactgaaaacaac
gcacccagtcaagaagccgagcttccgttcagcaaatggtcaccttctaagtacatatgg
agaggtttatcagttcctattatagcaggacaagtcgttctccggattttaaagggtaag
attcactggagaaacactcttcaacagctggagagaaccggaccgaaatctctaggagtt
tgtcttctgacttctacatttgttggtatggctttcacaatccagttcgttagagaattc
actagactaggtctaaacagatccattggaggtgtcttggctttagccttctctagagag
ctaagtccagtcatcacatcgattgttgttgctggacgaatgggaagtgcatttgcagct
gaactagggacaatgcaagtctcagagcaaactgatacactccgtgttttaggagctgac
ccaattgattatctaatcactccaagagtcatcgcctcgtgtttggctctaccgtttctg
acactcatgtgtttcactgttggtatggcttcaagcgctctgctctctgatgcagtttac
gggatcagcattaacataatcatggactcggctcaccgagcacttagaccatgggacatt
gtgagtgccatgattaaatctcaagtctttggagctataatatcggtaattagttgttct
tggggagtaaccactactggaggtgctaaaggtgttggagaatctacaacttctgctgtc
gtcatgtctcttgtcggaatcttcatcgcggactttgtgctttcttccttcttctttcaa
ggtgctggagattctttgaagaactgtgtttga

DBGET integrated database retrieval system