KEGG   Arabidopsis thaliana (thale cress): AT1G64970Help
Entry
AT1G64970         CDS       T00041                                 

Gene name
G-TMT
Definition
(RefSeq) gamma-tocopherol methyltransferase
  KO
K05928  tocopherol O-methyltransferase [EC:2.1.1.95]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00130  Ubiquinone and other terpenoid-quinone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00112  Tocopherol/tocotorienol biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AT1G64970 (G-TMT)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.95  tocopherol O-methyltransferase
     AT1G64970 (G-TMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 CMAS Methyltransf_12 Ubie_methyltran MTS ADH_zinc_N Methyltransf_32 NAS FtsJ Methyltransf_29 DREV
Motif
Other DBs
NCBI-GeneID: 842805
NCBI-ProteinID: NP_176677
MIPS: AT1G64970.1
TAIR: AT1G64970
Araport: AT1G64970
UniProt: Q9ZSK1
Position
1
AA seq 348 aa AA seqDB search
MKATLAAPSSLTSLPYRTNSSFGSKSSLLFRSPSSSSSVSMTTTRGNVAVAAAATSTEAL
RKGIAEFYNETSGLWEEIWGDHMHHGFYDPDSSVQLSDSGHKEAQIRMIEESLRFAGVTD
EEEEKKIKKVVDVGCGIGGSSRYLASKFGAECIGITLSPVQAKRANDLAAAQSLAHKASF
QVADALDQPFEDGKFDLVWSMESGEHMPDKAKFVKELVRVAAPGGRIIIVTWCHRNLSAG
EEALQPWEQNILDKICKTFYLPAWCSTDDYVNLLQSHSLQDIKCADWSENVAPFWPAVIR
TALTWKGLVSLLRSGMKSIKGALTMPLMIEGYKKGVIKFGIITCQKPL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaactctagcagcaccctcttctctcacaagcctcccttatcgaaccaactct
tctttcggctcaaagtcatcgcttctctttcggtctccatcctcctcctcctcagtctct
atgacgacaacgcgtggaaacgtggctgtggcggctgctgctacatccactgaggcgcta
agaaaaggaatagcggagttctacaatgaaacttcgggtttgtgggaagagatttgggga
gatcatatgcatcatggcttttatgaccctgattcttctgttcaactttctgattctggt
cacaaggaagctcagatccgtatgattgaagagtctctccgttttgccggtgttactgat
gaagaggaggagaaaaagataaagaaagtagtggatgttgggtgtgggattggaggaagc
tcaagatatcttgcctctaaatttggagctgaatgcattggcattactctcagccctgtt
caggccaagagagccaatgatctcgcggctgctcaatcactcgctcataaggcttccttc
caagttgcggatgcgttggatcagccattcgaagatggaaaattcgatctagtgtggtcg
atggagagtggtgagcatatgcctgacaaggccaagtttgtaaaagagttggtacgtgtg
gcggctccaggaggtaggataataatagtgacatggtgccatagaaatctatctgcgggg
gaggaagctttgcagccgtgggagcaaaacatcttggacaaaatctgtaagacgttctat
ctcccggcttggtgctccaccgatgattatgtcaacttgcttcaatcccattctctccag
gatattaagtgtgcggattggtcagagaacgtagctcctttctggcctgcggttatacgg
actgcattaacatggaagggccttgtgtctctgcttcgtagtggtatgaaaagtattaaa
ggagcattgacaatgccattgatgattgaaggttacaagaaaggtgtcattaagtttggt
atcatcacttgccagaagccactctaa

DBGET integrated database retrieval system