KEGG   Arabidopsis thaliana (thale cress): AT3G04890Help
Entry
AT3G04890         CDS       T00041                                 

Definition
(RefSeq) adenine phosphoribosyltransferase-like protein, putative (DUF2358)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2358 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 819649
NCBI-ProteinID: NP_001118575
MIPS: AT3G04890.1
TAIR: AT3G04890
Araport: AT3G04890
UniProt: B3H4P9
Position
3
AA seq 221 aa AA seqDB search
MAGVACQISISSSSTFRRVNQWPRCFSGSPEKKTPAVLKWAVSGVTEFLRLISGAPSSTS
IATNKDRSKNEVTAGDVDDVMGILRSDYRNFYFVTGVLTSAIYSDDCIFEDPTISFQGTE
LYERNLKLLVPFLEDASIELQNMEKSESSQRNYILATWKLRTYLKLPWRPLISINGNTVY
DLDKDFKALVFVQDCEACRELECLCARSNRADIHRQVFSLP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagtggcttgccagatatctatcagctcatcttcgacctttaggagggttaat
caatggccacggtgcttctctggttcgccggagaagaaaacaccagctgttttgaagtgg
gcggttagtggagttactgaatttctccggttgatctccggtgctccgtcttcaacctcc
atcgctacaaataaggatcgatcaaagaatgaggttactgctggagatgtcgatgatgtg
atggggattttgagatcagattatcgaaatttctacttcgtcactggagtcttgacttct
gcaatttactcggatgattgcatcttcgaggatccgactatcagcttccagggtacagag
ctgtatgaacgcaacttgaagttactggttccgttcctcgaagatgcatccattgaactg
caaaatatggagaagagtgagtcgtcccaaagaaactatatactagcgacgtggaagcta
agaacttacctgaagctgccatggagaccattgatatcgatcaacgggaatacggtttat
gatctggataaagacttcaaagcactggtttttgtacaagattgtgaggcatgtcgagag
ctggaatgtctctgcgctagaagcaatcgggcagatattcaccgtcaagtcttttccctt
ccgtga

DBGET integrated database retrieval system