KEGG   Arabidopsis thaliana (thale cress): AT3G19720Help
Entry
AT3G19720         CDS       T00041                                 

Gene name
ARC5
Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolases superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_N MMR_HSR1 AAA_16
Motif
Other DBs
NCBI-GeneID: 821509
NCBI-ProteinID: NP_188606
MIPS: AT3G19720.1
TAIR: AT3G19720
Araport: AT3G19720
UniProt: Q84N64 A0A178VCF9
Position
3
AA seq 777 aa AA seqDB search
MAEVSAKSVTVEEMAEEDDAAIEERWSLYEAYNELHALAQELETPFEAPAVLVVGQQTDG
KSALVEALMGFQFNHVGGGTKTRRPITLHMKYDPQCQFPLCHLGSDDDPSVSLPKSLSQI
QAYIEAENMRLEQEPCSPFSAKEIIVKVQYKYCPNLTIIDTPGLIAPAPGLKNRALQVQA
RAVEALVRAKMQHKEFIILCLEDSSDWSIATTRRIVMQVDPELSRTIVVSTKLDTKIPQF
SCSSDVEVFLSPPASALDSSLLGDSPFFTSVPSGRVGYGQDSVYKSNDEFKQAVSLREME
DIASLEKKLGRLLTKQEKSRIGISKLRLFLEELLWKRYKESVPLIIPLLGKEYRSTVRKL
DTVSKELSSLDEAKLKERGRTFHDLFLTKLSLLLKGTVVAPPDKFGETLQDERTQGGAFV
GTDGLQFSHKLIPNAGMRLYGGAQYHRAMAEFRFLVGAIKCPPITREEIVNACGVEDIHD
GTNYSRTACVIAVAKARETFEPFLHQLGARLLHILKRLLPISVYLLQKEGEYLSGHEVFL
KRVASAFNSFVESTEKSCRDKCMEDLASTTRYVTWSLHNKNRAGLRQFLDSFGGTEHNTT
SGNAIGFSLPQDALGGTTDTKSRSDVKLSHLASNIDSGSSIQTTEMRLADLLDSTLWNRK
LAPSSERIVYALVQQIFQGIREYFLASAELKFNCFLLMPIVDKLPALLREELENAFEDDL
DSIFDITNLRQSLDQKKRSTEIELRRIKRIKEKFRVMNEKLNSHEFAQNLKAPSVQH
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtatcagcaaaatcggtgacggttgaggaaatggcggaagaggacgacgct
gcgattgaggagcggtggagtctttacgaagcttacaacgagttacacgctttggcgcag
gaattggagacgccgttcgaagcaccggcggttcttgtggtgggacagcagaccgacggt
aaaagtgcgcttgtggaagctcttatggggtttcaatttaaccatgtcggcggcggaacc
aagactcgtcggccgattactctccatatgaagtacgatcctcagtgtcaattcccgctt
tgtcatctcggatctgatgatgatccttccgtttctcttcccaaatctctctcacaaatt
caggcatatattgaggctgagaacatgaggctggagcaagagccatgtagcccattctct
gcaaaggagattattgtgaaagtccagtataagtattgtccaaaccttaccatcattgat
acacctggacttattgctcctgcaccaggactgaaaaaccgagctcttcaggttcaagca
cgggctgtggaagctctagtccgagcaaagatgcaacacaaagagttcatcattttatgc
ctcgaagatagcagtgactggagcattgcaaccactcgaaggatagtgatgcaagttgat
cctgagctttctaggacaattgttgtttctacaaagcttgacactaaaatccctcaattc
tcatgttcatctgacgtggaagtctttctctcacctcctgcaagcgcacttgacagctcc
ttattgggcgattctccttttttcacgtctgtgccttctggaagagttggctatggacag
gattcagtgtataagtctaatgacgagttcaaacaggctgtgtcacttagagaaatggaa
gacattgcatctttagagaagaagttgggccgtttactgacaaaacaggaaaagagtagg
attggcatcagtaaactgaggttgtttctggaagaactactctggaaaaggtacaaagag
agtgttccattgatcattccactgttaggaaaggagtaccgcagtacagtcagaaagctg
gataccgtgagcaaggaacttagctctttggatgaagcaaaactcaaagagagaggcagg
actttccatgatctcttcttaaccaagttatcgctgttattgaagggaacagttgtggcc
cctccagataaatttggtgagacactgcaagatgaaaggacacaaggaggagcatttgtt
ggtactgatggtctccagttttcacataagctaataccgaatgcagggatgcgtctctat
gggggtgcacaatatcaccgtgccatggctgagtttcgttttctagttggtgctatcaaa
tgtcccccaataacgagggaggaaattgtaaatgcatgtggagttgaggatattcatgat
ggaacaaactattccagaacagcttgtgttatagcagttgcgaaggctcgtgagacgttt
gaacctttccttcatcagttaggggcgaggcttctacacattctcaagagattgcttcca
atttctgtatatcttcttcagaaagaaggtgaatatttaagtgggcatgaggtgtttctc
aagcgggttgcttcagcattcaacagttttgtggagtccacagaaaaatcatgtcgtgac
aaatgtatggaggatttagcaagtacaactcgctatgttacatggtctcttcacaacaag
aaccgagctggtctacgtcaattcttggactcatttggtggaacagagcataatacgaca
tcaggtaatgccataggatttagtcttccccaagatgcattaggtggcacaacagacacc
aagtcaagatcagatgtaaagctaagccatctcgcctcaaacatcgattcaggttccagt
attcagacaacagaaatgcggttggctgatcttctagatagcacactttggaaccgcaag
cttgctccttcctctgagagaattgtgtacgcattggtccaacagatattccagggcata
cgagagtactttctcgcctctgctgagttaaagttcaactgttttcttctaatgcccatc
gttgataagttacctgctcttctccgggaagagttggaaaacgcatttgaagacgacctc
gatagtatcttcgacatcacgaatctccggcaatcacttgatcaaaagaaacggagcaca
gagatcgagctcagaaggataaagaggataaaagagaaattcagagtgatgaatgagaag
ctaaactctcatgaatttgctcaaaatctaaaggctccttcggtgcagcattga

DBGET integrated database retrieval system