KEGG   Arabidopsis thaliana (thale cress): AT3G45060
Entry
AT3G45060         CDS       T00041                                 

Symbol
NRT2.6
Name
(RefSeq) high affinity nitrate transporter 2.6
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Module
ath_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT3G45060 (NRT2.6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G45060 (NRT2.6)
Transporters [BR:ath02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    AT3G45060 (NRT2.6)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 823641
NCBI-ProteinID: NP_190092
TAIR: AT3G45060
UniProt: Q9LXH0 A0A178V6D4
Position
3:complement(16477561..16479559)
AA seq 542 aa
MAHNHSNEDGSIGTSLHGVTAREQVFSFSVQEDVPSSQAVRTNDPTAKFALPVDSEHRAK
VFKPLSFAKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSG
AIFSRLAMGAVCDLLGARYGTAFSLMLTAPAVFSMSFVADAGSYLAVRFMIGFCLATFVS
CQYWTSVMFTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLTGATPFTAWRFAFFI
PGILQIVMGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFMLYGF
SMGVELTINNVISGYFYDRFNLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRG
RLWILWILQTVGALFCIWLGRASSLPIAILAMMLFSMGTQAACGALFGVAPFVSRRSLGL
ISGLTGAGGNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCSLPVAFIHFPQWGSMFLR
PSQDGEKSKEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRKAMLADIPTPETGSPA
HV
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggctcacaaccattctaatgaagacggctctattggaacctccttgcatggagtcacg
gcaagggagcaagtcttctccttctccgtccaagaagatgtcccttcatctcaagccgtc
cgaacaaacgatccaacggctaagtttgccctaccagtggactccgaacatagggcaaaa
gtgttcaaaccactatcattcgctaaaccacatatgagagccttccacttaggatggatc
tctttcttcacttgcttcatctccaccttcgcagccgcacctctagtccccgtcattcgc
gacaatctcgacctgaccaaaaccgacatcggaaatgctggagttgcatcagtttccggc
gccattttctcgagactcgctatgggtgctgtatgtgaccttctaggggcacgttatgga
accgccttctcacttatgcttacagctccagcagttttctccatgtcgttcgtagctgac
gcgggaagctacttagccgtaaggttcatgatcggtttttgcttagcaacgttcgtatca
tgtcagtactggacgagtgttatgttcactggaaagattatcggactcgttaacggatgt
gctggagggtggggagatatgggaggaggagtgactcagctactaatgccaatggtcttc
cacgtcatcaaactcaccggagccactcccttcacggcttggaggttcgccttcttcatc
cccggcattcttcagatagttatgggtattctcgttctcactctcggccaagatcttccc
gatggtaacctcagtactctccaaaagagtggtcaagtttctaaagacaaattctccaag
gtcttttggttcgctgtgaaaaactatagaacatggatcttattcatgctctatggattt
tctatgggagttgaattaacgatcaacaacgttatatctggatacttctacgataggttt
aaccttacgcttcacacagctggtattatagcagccagctttggtatggcaaacttcttt
gcccgtccttttggtggctacgcttcagatgtagctgcacggctcttcggtatgagggga
cggttatggatcttgtggatcttacaaactgttggagctctcttttgcatctggcttggt
cgtgctagttcactacctatagctatcttagccatgatgcttttttccatgggcacacaa
gctgcttgtggagctctctttggtgttgctccttttgtttcccgccgttctcttggactt
atctcgggattaactggtgctggtggaaattttgggtcgggagttactcaacttcttttc
ttctcttcctcgaggtttagtacggcggaaggactatcgttgatgggcgttatggctgtt
gtgtgctctcttccggttgcgtttatacattttccgcagtggggaagcatgttcttgagg
ccatcacaagatggagagaaatcaaaggaagagcattactatggagcggaatggacagag
gaagagaagagcttaggactacacgaaggaagcattaaatttgctgaaaacagccggtca
gagagaggccgcaaggcgatgttggctgatattccaacgccggaaaccggatctccggct
catgtctag

DBGET integrated database retrieval system