KEGG   Arabidopsis thaliana (thale cress): AT5G60780
Entry
AT5G60780         CDS       T00041                                 

Symbol
NRT2.3
Name
(RefSeq) nitrate transporter 2.3
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Module
ath_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT5G60780 (NRT2.3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT5G60780 (NRT2.3)
Transporters [BR:ath02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    AT5G60780 (NRT2.3)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 836199
NCBI-ProteinID: NP_200886
TAIR: AT5G60780
UniProt: Q9FJH7 A0A178UID3
Position
5:24450745..24452964
AA seq 539 aa
MTHNHSNEEGSIGTSLHGVTAREQVFSFSVDASSQTVQSDDPTAKFALPVDSEHRAKVFN
PLSFAKPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIF
SRLAMGAVCDLLGARYGTAFSLMLTAPTVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQY
WTSVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRIAFFVPGF
LQVVMGILVLSLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGSSMG
IELTINNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARVFGMRGRLW
TLWIFQTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISG
LTGAGGNFGSGLTQLLFFSSARFSTAEGLSLMGVMAVLCTLPVAFIHFPQWGSMFLRPST
DGERSQEEYYYGSEWTENEKQQGLHEGSIKFAENSRSERGRKVALANIPTPENGTPSHV
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgactcacaaccattctaatgaagaaggctccattggaacctccttgcatggagttaca
gcaagagaacaagtcttctctttctccgtcgatgcttcgtctcaaacagtccaatcagac
gatccaacagctaaattcgcccttccggttgattccgaacatcgagccaaagtgttcaac
ccactctcttttgctaaacctcacatgagagccttccacttaggatggctctcattcttc
acatgcttcatctccaccttcgcggcagcaccattagtccccatcatccgcgacaacctc
gacctcactaaaaccgacattggaaacgccggagtcgcatccgtctctggtgccattttc
tcaaggttagccatgggagcggtttgtgatctcctcggtgcacgatatgggactgccttc
tccctcatgctaaccgccccaaccgtcttctcaatgtcgtttgtgggtggccctagcgga
tacttaggcgtccggttcatgatcggattctgtctcgccacgtttgtatcatgccagtat
tggaccagcgttatgttcaacggtaagatcataggactagtgaacggctgtgcaggcggg
tggggtgatatgggcggtggagtgactcaactcctaatgccgatggtcttccacgtcatc
aaacttgccggagccactccgttcatggcctggcggatagctttcttcgttcccggattt
cttcaagttgttatgggcattctcgtcctcagtctcggccaagatctccctgacggtaac
ctaagtacccttcagaagagtggtcaagtctctaaagacaaattctccaaggttttctgg
tttgctgtgaagaactacagaacatggattttattcgttctttatggatcttccatggga
attgaattaactatcaacaacgttatctccggatatttttacgacaggtttaaccttaag
cttcaaacagctggtatagtagcagccagctttggaatggctaacttcatcgcccgtccc
ttcggtggttacgcttctgatgtagcggctcgggtttttggcatgagaggccggttatgg
accttatggatctttcaaaccgtaggagctcttttctgtatctggctaggtcgagctagt
tcacttcccatagcaatcctagcaatgatgctcttctcaatcggtacacaagcagcttgc
ggagccctcttcggagttgcaccttttgtctcgcgccgctctctagggctcatatcggga
ctaaccggcgcaggaggaaacttcgggtccggtttgactcaactgcttttcttctcatca
gcgaggtttagtacagctgagggactctcattgatgggcgttatggcggttttgtgcaca
ctcccagttgcgtttatacattttccgcaatggggaagcatgtttttaagaccgtcgacc
gatggagaaagatcacaggaggaatattattacggttctgagtggacggagaatgagaaa
caacaaggattgcacgaaggaagcatcaaatttgcagagaatagtaggtcagagagaggc
cggaaagtagctttggctaacattccaacgccggagaacggaactccaagtcatgtttga

DBGET integrated database retrieval system