KEGG   Azospirillum thiophilum: AL072_14955Help
Entry
AL072_14955       CDS       T04091                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ati  Azospirillum thiophilum
Pathway
ati00630  Glyoxylate and dicarboxylate metabolism
ati00710  Carbon fixation in photosynthetic organisms
ati01100  Metabolic pathways
ati01110  Biosynthesis of secondary metabolites
ati01120  Microbial metabolism in diverse environments
ati01130  Biosynthesis of antibiotics
ati01200  Carbon metabolism
Module
ati_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ati_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AL072_14955
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AL072_14955
Enzymes [BR:ati01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AL072_14955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALG72409
UniProt: A0A0F2KP13
Position
2:234624..236042
Genome map
AA seq 472 aa AA seqDB search
MHADRIEATYLIETPLAPAKVAEVMAGEQSCGTFTRVHGETDDLRARARAIVESVEKLDV
AETPALPNSWLERQRNSGPWQRARVTISFPTGNIGANLPTLAATVAGNLYDLGEVTGLRL
ESLRLPQAYRDRFDRPVHGIAGTRRLTGVADGPLVGSILKPNVGLSAEETGDLVGTLCAA
GLDFIKDDEICADPVHAPLAQRIPAVMDRVRRHQDRTGKHVMVAFNITDETDAMRRHADL
VEREGGSCIMVSLNWCGHSAVQTLRRHSGLVLHGHRNGFGALSRHPLLGIGFDAYQALWR
LAGVDHMHVHGLDGKFAQPDAEVIDGARACLAPLAYDAPPLPPGERVGVRGTHGVDLGKP
DTPTPADTSMQRAPLTPTLSPGGRGDVGDVVMPAFSSGQWAGTVPVTWEAVGTADLLFMS
GGGIMAHPDGPDAGVRSIRQAWDAVRAGRRLEDAAAEQPELRHALDFFGRKG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccgaccgcatcgaagcgacatacctgatcgaaacccccctcgctccggccaag
gtggcggaggtgatggcgggcgagcagtcctgcggcaccttcacccgtgtccatggcgag
accgacgacctgcgcgcccgcgcccgcgccatcgtggaatcggtggagaagctcgacgtc
gccgaaacgccggccctgcccaacagctggctggagcgccagcgcaattcgggcccgtgg
cagcgggcgcgcgtcaccatctccttcccgaccggcaacatcggcgccaacctgccgacg
ctggccgccaccgttgccggcaacctctacgacctgggggaggtgaccggcctgcggctt
gagtccctgcggctgccgcaggcctaccgcgaccgcttcgaccggccggtccacggcatc
gccggcacccggcggctgaccggggtggccgacgggccgctggtcggctcgatcctcaag
cccaatgtcgggctgtcggccgaggagaccggcgatctggtcggcaccctgtgcgccgcc
gggctcgacttcatcaaggacgacgagatctgcgccgatccggtgcatgcgccgctggcc
cagcgcatcccggcggtgatggaccgggtgcgccgccaccaggaccgcaccggcaagcat
gtgatggtcgccttcaacatcaccgacgagaccgacgccatgcgccgccatgccgatctg
gtggagcgcgagggcgggtcctgcatcatggtcagcctgaactggtgcggccattcggcg
gtccagacgctgcgccggcacagcgggctggtgctgcacggccaccgcaacggcttcggc
gccctgtcgcgccatccgctgctcggcatcggcttcgacgcctatcaggcgctgtggcgt
ctggccggcgtcgaccacatgcatgtccatggcctggacggcaagttcgcccagcccgac
gcagaggtgatcgacggcgcccgcgcctgcctcgcgccgctggcttatgatgctccccct
ctcccccccggggagagggtcggggtgagggggacgcacggcgtggatttggggaaaccg
gatacgccgacgcctgccgacacctccatgcaacgcgcccccctcaccccaaccctctcc
ccgggggggagaggggatgtgggggacgtcgtcatgcccgccttctcgtccgggcaatgg
gccggcacggtgccggtcacctgggaggcggtggggacggccgacctgctgttcatgtcc
ggcggcggcatcatggcccatcccgacggcccggatgccggggtgcgcagcatccgccag
gcctgggacgcggtgcgcgccggtcgccggctggaggatgccgcggcggagcagccggag
ctgcgtcacgccctggatttcttcggcaggaagggctga

DBGET integrated database retrieval system