KEGG   Azospirillum thiophilum: AL072_15760Help
Entry
AL072_15760       CDS       T04091                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ati  Azospirillum thiophilum
Pathway
ati00620  Pyruvate metabolism
ati00630  Glyoxylate and dicarboxylate metabolism
ati01100  Metabolic pathways
ati01110  Biosynthesis of secondary metabolites
ati01120  Microbial metabolism in diverse environments
ati01200  Carbon metabolism
Module
ati_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL072_15760
   00630 Glyoxylate and dicarboxylate metabolism
    AL072_15760
Enzymes [BR:ati01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AL072_15760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ALG72537
UniProt: A0A0F2KSU0
Position
2:427809..429980
Genome map
AA seq 723 aa AA seqDB search
MSNWIRRGGLEIAQPLYDFINDEALPGTGVDADRLWSGLDALLHDLAPRNRALLDKRDSL
QAQIDAWHTARRGTLFDQAEYESFLRGIGYLVPEGEDFSVGTGNVDPEIAYLAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDAIPGTPAAGGYDAARGAQVIAWARRFLDDSVPLA
GGSHADATGYAVEGDALAVTLKDGGKTGLKDKAAFVGWQGDAAAPSAVLLVQNGTHIEIR
IDRASMIGKDDPAGVADVVLEAALSTIQDCEDSVAAVDAEDKVGAYRNWLGLMTGTLEAS
FPKGDRTVVRKLNPDRVYTTPAGTLTLHGRSLLLVRNVGHLMTIDMVKLSDGSEAPEGIL
DGVFTSLIALHDLKAPQKADGGLRNSRAGSVYIVKPKMHGPEEVAFTDELFGRVEDLLGM
ARNTLKVGIMDEERRTSVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPVVRKAA
MKATKWISAYEDNNVDVGLRAGLKGRAQIGKGMWAMPDLMADMLVAKIGHPKAGANTAWV
PSPTAATLHATHYHAVNVAEVQDLLAKRQAAALSDILTLPLADRPNWSEDEIRQELENNA
QGILGYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGICTEAQVMEVM
KRMAAVVDKQNAGDPLYKPMAGNFDGSIAFQAACDLVFKGRVQPNGYTEPVLHARRRQVK
AAV
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactggattcgccgcggcggcctcgagatcgcccaacccctctatgacttcatc
aatgacgaggctttgcccgggaccggtgtcgacgccgatcgtctgtggagcggcctggac
gcgctgctgcacgatctggcgccgcgcaacagggcgctgctggacaagcgcgacagcctg
caggcgcagatcgatgcgtggcacaccgcgcgccgcggcacgctcttcgaccaggccgaa
tatgagtccttcctgcgcgggatcggctatctcgtgccggagggcgaggatttcagtgtc
ggcaccggcaatgtcgatcctgagatcgcctatctcgccggcccgcagctggtggtgccg
atcaccaatgcccgctatgccctgaacgccgccaatgcgcgctggggcagcctgtatgac
gcgctgtacggcaccgatgcgatcccgggcaccccggcggccggcggctacgatgccgcg
cgcggcgcgcaggtgatcgcctgggcgcgcaggttcctggacgacagcgtgccgctggcc
ggcggcagccatgccgacgccaccggctatgcggtcgagggcgatgcgctggcggtgacg
ctgaaggacggcggcaagaccggcctgaaggacaaggccgccttcgtcggctggcagggc
gatgccgcggccccgtcggcggtgctgctggtccagaacggcacccatatcgagatccgc
atcgaccgcgccagcatgatcggcaaggacgatccggccggtgtcgccgacgtcgtgctg
gaagcggcgctgtcgaccatccaggactgcgaggattccgtcgccgccgtggatgccgag
gacaaggtcggcgcctaccgcaactggctcggcctgatgacgggcacgctggaggccagc
ttccccaagggtgacaggaccgtcgtccgcaagctgaaccccgaccgcgtctataccacg
ccggccggcacgctgaccctgcacggccgcagcctgctgctggtccgcaacgtcggccac
ctgatgaccatcgacatggtcaagctgtccgacggcagcgaggcgccggaaggcatcctg
gacggcgtcttcacctcgctgatcgccctccatgacctgaaggcccctcaaaaagctgat
ggcggcttgcgcaacagccgcgccggctcggtctacatcgtgaagccgaagatgcacggg
cccgaggaggtcgccttcaccgacgagctgttcggccgcgtcgaggatctgctgggcatg
gcccgcaacaccctcaaggtcggcatcatggacgaggagcggcggaccagcgtcaacctc
aaggagtgcattcgcgccgccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgtaccggcgacgaaatccacacctcgatggaggccggcccggtcgtccgcaaggcggcg
atgaaggccaccaaatggatctcggcctatgaggacaacaatgtcgacgtcggcctgcgc
gccgggctgaagggccgtgcccagatcggcaagggcatgtgggcgatgcccgacctgatg
gccgacatgctggtcgccaagatcggccatccgaaggccggcgccaacaccgcctgggtt
ccgtcgccgaccgccgccacgctgcacgcaacccactatcacgctgtcaacgtcgccgag
gtgcaggacctgctggccaagcgccaggcggcagccctgtccgacattctgaccctcccg
ctcgccgaccgtcccaactggtcggaggacgagatccggcaggagctggagaacaatgcc
cagggcatcctgggttacgtcgtgcgctgggtcgaccagggcgtcggctgttccaaggtg
ccggacatccatgacgtcggcctgatggaggaccgcgccaccctgcgcatctccagccag
cacatcgccaactggctgcatcacggcatctgcaccgaggcccaggtgatggaggtcatg
aagcgcatggccgccgtcgtcgacaagcagaatgccggcgacccgctgtacaagccgatg
gccggcaatttcgacggcagcatcgcattccaggcggcctgcgatctggtgttcaagggc
cgcgttcagccaaacggctacaccgaaccggtgctgcacgcccgtcgccgtcaggtgaag
gcggcggtgtaa

DBGET integrated database retrieval system