KEGG   Azospirillum thiophilum: AL072_16980Help
Entry
AL072_16980       CDS       T04091                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ati  Azospirillum thiophilum
Pathway
ati00071  Fatty acid degradation
ati00072  Synthesis and degradation of ketone bodies
ati00280  Valine, leucine and isoleucine degradation
ati00310  Lysine degradation
ati00362  Benzoate degradation
ati00380  Tryptophan metabolism
ati00620  Pyruvate metabolism
ati00630  Glyoxylate and dicarboxylate metabolism
ati00640  Propanoate metabolism
ati00650  Butanoate metabolism
ati00900  Terpenoid backbone biosynthesis
ati01100  Metabolic pathways
ati01110  Biosynthesis of secondary metabolites
ati01120  Microbial metabolism in diverse environments
ati01130  Biosynthesis of antibiotics
ati01200  Carbon metabolism
ati01212  Fatty acid metabolism
ati02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL072_16980
   00630 Glyoxylate and dicarboxylate metabolism
    AL072_16980
   00640 Propanoate metabolism
    AL072_16980
   00650 Butanoate metabolism
    AL072_16980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL072_16980
   00072 Synthesis and degradation of ketone bodies
    AL072_16980
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL072_16980
   00310 Lysine degradation
    AL072_16980
   00380 Tryptophan metabolism
    AL072_16980
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL072_16980
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL072_16980
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL072_16980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ati04147]
    AL072_16980
Enzymes [BR:ati01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL072_16980
Exosome [BR:ati04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL072_16980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALG72707
UniProt: A0A0F2KXI3
Position
2:complement(764061..765233)
Genome map
AA seq 390 aa AA seqDB search
MTGRPIIVAARRTAVGRIGGSLRDLPVQDLAAPVIQAVLADAGIDPGEVDDVVLGNAVGP
GGNVARLSALAAGLPVSVPGVTVDRQCGSGLEAINLAARLIQAGAGDVFLAGGVESTSTA
PWRVAKPTNLYRSPVFYDRARFAPDSVGDPSMIEAAEAVAAAYGIDRARQDRYALNSHRK
AVASRLTGRFDREIVPLTLPDGRIVDRDECPRADTSLDRLAMLRPIVRPDGTVTAGNACP
VNDGAAVVAVVSERKFQALGLTRGLMVVDSAAAGVAPNLLGTGPIPAVRKLLTRNPGLTV
AGIDLIEFNEAFAAQVLACLDALEIEESRVCVGGGALALGHPYGASGGILATRLFSELLF
PVAGTAPRRGLATLGIGGGLGLATLLESVS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgcccgatcatcgtcgcggcacgccgcactgcggtcggccgcatcggcggc
tccctgcgcgacctgcccgtccaggacctcgccgcgcccgtcatccaagccgtgctcgcc
gacgccgggatcgatccgggcgaggtggatgacgtcgtgctcggcaacgcggtcggcccc
ggcggcaacgtcgcgcgactgtcggcgctggcggccgggctgccggtgtcggtgcccggc
gtcacggtggaccgccagtgcgggtcgggcctggaggccatcaacctcgcagcccggttg
atccaggccggcgccggcgacgtattcctggccggcggggtggagagcacgagcaccgcg
ccatggcgggtcgccaagccgaccaacctctaccgcagcccggtcttctacgaccgcgcc
cgcttcgccccggacagcgtcggcgacccgtcgatgatcgaggcggcggaggcagtcgca
gccgcgtacggcatcgaccgggcccgccaggaccgctatgccttgaacagccaccgcaag
gcggtcgcctcccgcctcaccggccgtttcgaccgggaaatcgttccgctcaccctgccg
gacggccggatcgtcgaccgcgacgaatgcccgcgcgccgacaccagcctggaccgtctg
gcgatgctgcgccccatcgtaaggccggacgggacggtgactgcgggcaatgcctgcccg
gtcaacgacggtgccgccgtggtcgcggtggtgtcggagaggaaattccaggcgctgggc
ctgacccgcggcttgatggtggtggattcggctgcggcaggggtcgcccccaacctgctc
ggcaccggcccgattcctgcggtacgcaaactcctgacccgcaatcccgggctgacggtc
gccggtatcgacctcatcgagttcaacgaggcgttcgccgcccaggtgctggcctgcctc
gacgcactggagatcgaagaatcccgtgtctgtgtcggcggcggcgccctcgccctcggc
catccctacggcgcgtcgggaggcatcctggcaacccggctgttctccgaacttctgttc
ccggtcgcgggcaccgccccccgcaggggcctcgccacgctcggcatcggtggcgggctg
ggcctcgccacacttctggaatctgtttcatga

DBGET integrated database retrieval system