KEGG   Azospirillum thiophilum: AL072_20730Help
Entry
AL072_20730       CDS       T04091                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
ati  Azospirillum thiophilum
Pathway
ati01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ati00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AL072_20730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ati01011]
    AL072_20730
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ati03036]
    AL072_20730
Enzymes [BR:ati01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     AL072_20730
Peptidoglycan biosynthesis and degradation proteins [BR:ati01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   AL072_20730
Chromosome and associated proteins [BR:ati03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    AL072_20730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3
Motif
Other DBs
NCBI-ProteinID: ALG73838
UniProt: A0A0F2KPW1
Position
3:334702..335544
Genome map
AA seq 280 aa AA seqDB search
MDRRQLLGLGLSKLWLTALGTAGLALAQPFGSGAALAGQRRPERKPVAAPPARARLVMLD
PGHGGNDPGAIGTRGTFEKDVTLDIARSVARTLAERSGVAVKLTRRDDRFLALDDRVALA
RETGADLFVSIHADSAPNADARGLSAYILSDKASDAFASRLAQQENRADRFGKPGTMGGG
RIVKDILLDLTARHTRHASLAARQLLVEGAGKELHLLDNPMRSANFAVLKAPDVPSVLVE
TGFLTNPKDEEILRDPTARRVVARVLAREIAAVLSSPAFA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacgacagctgcttgggctcgggctgagcaagctttggttaacggcgctcggc
acggccggcctcgcgctggcgcagccgttcgggtccggcgcggccctcgccggccagcgg
cggcccgagcgcaagccggtcgccgccccgccggcgcgggcacggctggtgatgctcgac
cccggtcacggcggcaacgatcccggcgccatcggcacgcgcggcaccttcgagaaggac
gtgacgctggacatcgcccgcagcgtcgcccggacgctggcggagcggagtggcgtcgcg
gtgaagctgacgcggcgcgacgaccgtttcctggcgctggacgaccgggtggccctggcg
cgcgagaccggcgccgacctgttcgtatcgatccacgccgacagcgcgcccaatgccgat
gcccgcggcctgtcggcctacatcctgtcggacaaggcatccgacgccttcgcctcacgc
ctcgcccagcaggagaaccgggccgaccgattcggcaagccggggacgatgggcggcgga
cggatcgtcaaggacatcctgctcgacctgaccgcccgccacacccgccatgcctcgctg
gccgcgcgccagctgctggtggagggggcgggaaaggagctgcacctgctcgacaacccg
atgcgctcggccaatttcgcggttctgaaggcgccggacgtgccgtcggtgctggtcgag
accggcttcctcaccaacccgaaggacgaggagatcctgcgcgaccccaccgcgcggcgg
gtggtcgcccgcgtactggcgcgcgagatcgcagccgtgctgtccagcccagctttcgcc
tga

DBGET integrated database retrieval system