KEGG   Azospirillum thiophilum: AL072_25825Help
Entry
AL072_25825       CDS       T04091                                 

Definition
(GenBank) carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ati  Azospirillum thiophilum
Pathway
ati00620  Pyruvate metabolism
ati01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ati00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL072_25825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ati02000]
    AL072_25825
Enzymes [BR:ati01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AL072_25825
Transporters [BR:ati02000]
 Other transporters
  Primary active transporters [TC:3]
   AL072_25825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ALG74359
UniProt: A0A0F2KSU6
Position
4:672733..674241
Genome map
AA seq 502 aa AA seqDB search
MTARQPSFAPLHPAARDAGEVQIVDTTLRDAQQCLWTTRMTAGMMLPIADAMERANFAMI
DFMAPVQFDVCVRYLKEDPWEKARFFRSKFQRTPLRGYCRSKSLLGFSLVPDDIVELWIE
RLCANGFSVVGTLDALFDIDNMVLSLRKAKRMGMWAVGALVFCESPLHTDDLYARTARAL
IEKADVDAIMIKDSGALLTPDRIRTLVPALKAVMGSRPLELHSHCNTGLAPLVYLEGARL
GVDQLHTSIAPLASGPAQPSVQGTLRNLDLAGWKTMVDRPAVDEISAYLEDLAAQEGFPV
GRPMEYDSFHYRHQMPGGMLANWRFQLRQNGLEHRFDEILYEVARVREELAWPIMVTPFA
QIIAVQAMLNVVHGERYRVVPDEVKMYALGHFGRLLAPVAPDVLDRIVANGSPKIPLTPE
PLPPALPELRRKYPNASDDERLLRFMFAGDEVGEMIAAGPLRTGPVLRQPLERLLSALLD
RPAVKHFQVEKGASRFSLSRSA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgccagcccagcttcgcccccctgcatccggccgcccgcgacgcgggggag
gtgcagatcgtcgacaccacgctgcgcgacgcgcagcaatgcctgtggaccacccgcatg
acggcggggatgatgctgccgatcgccgacgcgatggagcgggcgaacttcgccatgatc
gacttcatggcgccggtgcagttcgacgtctgcgtccgttacctgaaggaagacccgtgg
gagaaggcccgcttcttccgctcgaagttccagcgcaccccgctgcgcggctattgccgc
agcaagagcctgctcggcttcagcctggttcccgacgacatcgtggaattgtggatcgaa
cggctgtgcgccaacggcttcagcgtcgtcggcacgctcgacgccctgttcgacatcgac
aacatggtgctcagcctgcgcaaggcgaagcggatggggatgtgggcggtcggcgccctg
gtcttctgcgaaagcccgctgcacaccgacgacctctacgcccgcaccgcgcgggcgctg
atcgagaaggccgacgtcgacgcgatcatgatcaaggattccggcgcgctgctgacgccg
gaccgcatccgcacgctggtcccggcgctgaaggcggtgatggggtcgcgcccgctggag
ctgcacagccattgcaacaccgggctggccccgctggtctatctggaaggggcgcgcctg
ggcgtcgaccagttgcacacctccatcgcgccgctcgccagcggtccggcccaaccgtcg
gtgcagggaaccctgcgcaacctggatctggccggatggaagaccatggtcgaccggccg
gcggtggacgagatcagcgcctatctggaggatctggccgcccaggaaggtttcccggtc
ggacggccgatggagtatgattccttccattaccgccaccagatgcctggcggcatgctc
gccaactggcggttccagcttcgccagaacgggctggagcaccgtttcgacgagatcctg
tacgaggtcgcccgcgtgcgcgaggagttggcctggccgatcatggtgacgcctttcgcg
cagatcatcgcggtgcaggcgatgctgaacgtcgtccatggcgagcggtaccgcgtggtg
cccgacgaggtgaagatgtacgcgctcgggcatttcggccggctgctggcgccggtggcg
cccgacgtgctcgaccgcatcgtcgccaacgggtcgccgaagatcccgctgacgccggaa
cccctgccgccggccctgccggagttgcggcggaaatacccgaacgccagcgacgacgag
cgcctgctgcgcttcatgttcgcgggcgacgaggtcggggagatgatcgccgccggaccg
ctgcggaccgggccggtgttgcggcaaccgctcgaacggctgttgagcgccttgctcgac
cgcccggcggtgaagcatttccaggtggaaaagggggcgtcccggttcagcctctcacgg
tcggcgtga

DBGET integrated database retrieval system