KEGG   Anaerolinea thermophila: ANT_00050
Entry
ANT_00050         CDS       T01410                                 

Gene name
lpd
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00260  Glycine, serine and threonine metabolism
atm00280  Valine, leucine and isoleucine degradation
atm00310  Lysine degradation
atm00380  Tryptophan metabolism
atm00620  Pyruvate metabolism
atm00630  Glyoxylate and dicarboxylate metabolism
atm00640  Propanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
atm01240  Biosynthesis of cofactors
Module
atm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_00050 (lpd)
   00020 Citrate cycle (TCA cycle)
    ANT_00050 (lpd)
   00620 Pyruvate metabolism
    ANT_00050 (lpd)
   00630 Glyoxylate and dicarboxylate metabolism
    ANT_00050 (lpd)
   00640 Propanoate metabolism
    ANT_00050 (lpd)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_00050 (lpd)
   00280 Valine, leucine and isoleucine degradation
    ANT_00050 (lpd)
   00310 Lysine degradation
    ANT_00050 (lpd)
   00380 Tryptophan metabolism
    ANT_00050 (lpd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atm04147]
    ANT_00050 (lpd)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ANT_00050 (lpd)
Exosome [BR:atm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ANT_00050 (lpd)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA HI0933_like FAD_oxidored K_oxygenase FAD_binding_3 FAD_binding_2 DAO NAD_binding_8 Thi4 3HCDH_N Lycopene_cycl UnbV_ASPIC
Other DBs
NCBI-ProteinID: BAJ62039
UniProt: E8MY94
Position
complement(2300..3697)
AA seq 465 aa
MNEYDVIVIGAGPGGYVSAIRSAQLGLKTAIVDKQWLGGVCLNVGCIPSKSLLKNAEVAH
TLRERGREFGFAFENLTLDYSVAVKRSRQVSDRLTKGVGFLMKKNGIDVHMGTARLTARD
TVRVTDKDGKVTDLKAKNIIIATGASAAVIPGVKVDGEKVVTYWEAILQTRLPKSVIVIG
GGAIGLEFSTVWNAYGSEVTIVEMLPRIAPLEDEEISAELTKAFQKRGINVLAGHRVQSV
ETTESGVRVVVSGESGEKTLEAEQALLAIGFKPNSRDLGLEEVGVKVNERGFIEVDERMA
TSVPGIWAIGDVTGKLLLAHVASAQGIACAEAIASLPVQPIDYRMIPRATYCQPQVASFG
LTEAQAKEAGYSVKVGRFPFQPNGKALGLGDYTGFVKIIVDEKHGEILGAHMIGPEVTEL
LPELTLAQRSELTIEEVARNIHAHPTLSEVIMEAAEAALGHAIHI
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaacgagtacgatgtcatcgtcattggagcgggacccggcggttacgtcagcgccatc
cgctcggcgcagttaggcttgaaaaccgccatcgtggataagcagtggctgggcggcgtg
tgcctgaacgtgggctgtattccgtccaaatccctgctcaagaatgccgaagttgcccac
accctgcgcgaacgcgggcgcgagttcggctttgcctttgaaaacctcaccctggattac
agcgtggcggtcaagcgcagtcgtcaggtctccgaccgcctgaccaagggcgtgggcttc
ctgatgaagaaaaacggcattgacgtgcacatgggcactgcccgcctgactgcccgcgac
accgtccgggtgaccgacaaggacggcaaggtcaccgacctgaaagccaaaaacatcatc
attgccaccggcgcttcggcggcggtcattcccggggtgaaggtggacggcgagaaggtc
gtcacctactgggaagccatcctgcaaacccgcctgcccaaatcggtcatcgtcatcggc
ggcggcgccatcgggctggaattttccaccgtgtggaacgcctacggcagtgaggtgacc
attgtggaaatgctcccgcgcattgctccgctggaagatgaggaaatcagcgccgaactg
accaaagccttccagaagcgcggtatcaacgtgctggcgggtcaccgcgtgcagtcggtg
gagactaccgaaagcggcgtgcgtgtggtggtcagcggcgagagcggcgagaagacgctg
gaagccgaacaagccctgctggcgattggcttcaagcccaactcgcgcgacctgggactg
gaagaagtgggcgtcaaggtgaacgagcgcggcttcatcgaggtggatgagcgcatggca
accagtgtgccgggcatctgggcaattggcgatgtgaccggcaaacttctgctggcgcat
gtggcgtccgctcagggcattgcctgcgccgaagccatcgccagtctgccggtacagccc
attgactaccgcatgattccccgcgccacctactgtcagccgcaggtggcatcctttggg
cttaccgaagcgcaggcaaaggaagccgggtacagcgttaaggtggggcgcttccccttc
cagcccaacggcaaagccctgggcttgggcgattacaccggcttcgtcaagatcatcgtg
gacgagaaacacggcgaaatcctcggcgcgcacatgattggtccggaagtgaccgaactt
ctgcctgaactgacgctggcacagcgcagtgagttgaccattgaagaggtggcgcgcaac
atccatgcgcaccccacgctgagcgaagtcatcatggaagccgccgaagccgccctgggc
cacgcgattcatatttaa

DBGET integrated database retrieval system