KEGG   Anaerolinea thermophila: ANT_04500
Entry
ANT_04500         CDS       T01410                                 

Definition
(GenBank) putative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_04500
   00020 Citrate cycle (TCA cycle)
    ANT_04500
   00620 Pyruvate metabolism
    ANT_04500
   00650 Butanoate metabolism
    ANT_04500
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     ANT_04500
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     ANT_04500
SSDB
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N Abhydrolase_6
Other DBs
NCBI-ProteinID: BAJ62484
UniProt: E8N0T9
Position
484188..485303
AA seq 371 aa
MARELLKGNEAIAEAAIRAGLQAYFGYPITPQTELLEWMSKRMPELGRAFVQAESELAAI
NMVYGAACTGARVMTSSSSPGISLMMEGISYIIGTEVPAVLVDVMRGGPGLGNIAPAQSD
YNQIVHGGGHGDYHLIVLAPASVQEAVDLTVLAFDLAEKYRTVAVVLLDGSLGQMMEPAE
LPPMRPVKTVYPEWAATGMMGKREKNILTSIYLNPPDEEQTNLRLLRRWQEVEANEIRFK
EYFMDDARYVVVGFGSAGRVALSAVRAARAEGIPVGLLRPITLSPFPYAHIRKLAERVEG
FLVVEMNAGQMLEDVRLAVSGQKPVEFYGRLGGVMPFPDEILAEIQRIASGGLTLEGHPR
ERWLQRMNGKN
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcacgtgaattgctgaaagggaatgaagccattgccgaagccgctatccgcgcgggg
ttgcaggcatattttggctaccccatcacgccgcagaccgaactgctggaatggatgtcc
aagcgcatgcccgagttgggacgcgcctttgtacaggcagagtccgaacttgcggccatc
aacatggtgtacggagcggcgtgtaccggggcgagagtgatgacatcttcatccagcccc
ggtatcagtttaatgatggaggggatttcctacatcatcggcaccgaagtgcctgccgtg
ctggtggatgtgatgcgcggcggtccgggcttgggcaacattgccccggcgcagagcgac
tacaatcagattgtgcacggtggcgggcatggcgattatcacctcatcgtgctggcgcct
gccagcgtgcaggaagcggtggacctgaccgtgctggcgtttgacctggcggagaagtac
cgcacggttgctgtggttctgctggatggctcgctgggtcagatgatggaaccggcagaa
cttccccccatgcgcccggtgaagaccgtgtatcctgaatgggcggcaaccggcatgatg
ggcaagcgcgagaagaatatcctcaccagcatttacctcaacccccctgatgaggagcag
accaacctgcgcctcttgcgccgctggcaggaggtggaagccaacgaaatccgtttcaaa
gagtacttcatggacgatgcccgctatgtggtggttggctttggttcggcgggacgtgtg
gcgctttcggcagtacgcgccgcccgcgccgaaggcatcccggtgggcttgctacgcccc
attaccctcagtcctttcccttatgctcatattcgcaaattggcagaacgcgtggaggga
ttcctggtggtggagatgaacgccggacagatgctggaagacgtgcgcctggcggtttcc
ggacagaagccggtggagttttacgggcgcctgggtggggtgatgcccttcccggatgaa
atccttgccgagattcagcgcatcgcttccggtggattgacgctggaagggcacccgcgc
gaacgctggcttcagcgcatgaatggtaagaattag

KEGG   Anaerolinea thermophila: ANT_04510
Entry
ANT_04510         CDS       T01410                                 

Definition
(GenBank) putative 2-oxoglutarate ferredoxin oxidoreductase beta subunit
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_04510
   00020 Citrate cycle (TCA cycle)
    ANT_04510
   00620 Pyruvate metabolism
    ANT_04510
   00650 Butanoate metabolism
    ANT_04510
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     ANT_04510
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     ANT_04510
SSDB
Motif
Pfam: TPP_enzyme_C E1_dh
Other DBs
NCBI-ProteinID: BAJ62485
UniProt: E8N0U0
Position
485316..486098
AA seq 260 aa
MVMEQILPEEIVYQRPEALADVNTHYCPGCTHGVAHRLIAEVIDEMGIRDRMVGVASVGC
SVFAYNYFDFDWVQAPHGRAPAMATGIKRVLPDRFVVTYQGDGDMASIGMAEVVHAAARG
ENITVFFINNANYGMTGGQMAPTTLPGQRTTSSPSGRDVETAGYPIRAAELLATLEGASY
VVRRSLHDPKNIRLAKKAIRTALEVQAQGLGFSMVEFLSTCPTNWGMTPVDALHWLEEHM
IEYYPLGDFKVAPTVAQIRI
NT seq 783 nt   +upstreamnt  +downstreamnt
atggtcatggaacaaattcttccggaggaaatcgtctatcaacgccctgaggcgctggca
gatgtgaatacacattactgccccgggtgtacgcatggtgttgcccatcgcctgattgcc
gaggtgattgacgaaatgggcatccgcgaccgcatggtcggcgttgcctcggtgggatgt
tcggtgtttgcctataactactttgattttgactgggtgcaggcgccgcatggacgcgcc
cccgccatggcaaccggcatcaaacgcgtgttgcccgaccgttttgtggtcacctaccag
ggcgatggcgatatggcgtctatcggcatggcagaggtggtgcatgccgccgcccgtggg
gagaacatcaccgtgttcttcatcaacaacgccaactacggcatgaccggtggacaaatg
gcgcccaccactttgcccggtcagcgcactacctcgtcgcccagcgggcgcgacgtggaa
accgccgggtatcccatccgtgccgccgaattgctggcgacgctggaaggggcttcttat
gtggtgcgccgcagtctgcacgaccccaagaatatccgtctggcaaagaaagccatccgc
accgcgctggaggtgcaagcccaggggctgggcttttccatggtggaattcctctccacc
tgcccgacgaactggggcatgaccccggtggatgcgctccactggcttgaagagcacatg
attgagtattatccgctcggcgatttcaaagtcgctccaacggtggcgcagattcgcatc
taa

KEGG   Anaerolinea thermophila: ANT_18140
Entry
ANT_18140         CDS       T01410                                 

Definition
(GenBank) putative 2-oxoglutarate ferredoxin oxidoreductase beta subunit
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_18140
   00020 Citrate cycle (TCA cycle)
    ANT_18140
   00620 Pyruvate metabolism
    ANT_18140
   00650 Butanoate metabolism
    ANT_18140
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     ANT_18140
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     ANT_18140
SSDB
Motif
Pfam: TPP_enzyme_C PFO_beta_C
Other DBs
NCBI-ProteinID: BAJ63840
UniProt: E8N5X6
Position
complement(2043881..2044921)
AA seq 346 aa
MADIQALNAIGLSRTDYRGLPSTLCQGCGHNAVSNQIIQAMYEMNIQPEKIVKFSGIGCS
SKSPAYFLGRSFAFNGVHGRMPSLATGALFADTSLYGMGVSGDGDTASIGMGQFKHVIRR
NLPMVYIVENNGVYGLTKGQFSATAEKGLTLKHEGTNLFLPVDICLEALASNATFVARGF
AGDPKQLKELLKAAIKHRGTAVLDIISPCVTFNNKDDTIHSYAFGKEREVRLHDLIFVPA
RDQLTIEDFEEGTVRDVELYDGSVITLRKLERDYDPTSRSEAFRILEEARERRELITGLI
YVEPDAPSIFDLYELPEKPLNRMTEGELRPASQTLNQVHSWLFSNL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcagatattcaggctcttaatgcaatcggcctttcgcgaacagattatcgcggttta
ccctcaactttatgccagggctgtggacataatgcagtctccaatcagattattcaagcc
atgtacgaaatgaatatccagcccgagaaaattgtcaaattttcagggattggatgctcg
agtaaaagcccggcttatttcctggggcgttcttttgcgttcaacggtgtgcatgggcgc
atgccctctctggctacgggtgccttgtttgccgatacttctctgtacggcatgggggtg
agtggggatggtgacactgccagcattggcatggggcagttcaagcacgtcattcgccgc
aatttgcccatggtatatatcgttgagaataacggggtttacgggttgaccaaagggcaa
ttttctgccacagcagaaaagggattaaccctgaaacatgagggcacgaatttgttcctg
cctgtagatatttgtctggaagccctggcatctaatgcgacctttgtggcgcgtgggttt
gccggagaccccaagcaactcaaagaactgttgaaagcggcgattaaacatcgcggtaca
gccgtgctggatatcatcagcccttgtgtcactttcaataataaggacgatacaatccac
tcttatgcttttggcaaagagcgcgaagtccgtttgcacgatttgatttttgtgcctgct
cgggatcagttgaccatagaggattttgaagaaggtactgtgcgggatgtagaactctat
gatggttcggtgattaccctgcggaagctggaaagggattacgatccaaccagtcgaagc
gaggctttccgtattttggaagaggctcgcgaacggcgtgaattaatcaccggcttaatt
tatgttgagccggacgccccttcaatttttgacctttacgagttgcctgaaaagccctta
aaccggatgacggagggagaattacgtcccgcatcccaaacgctcaaccaagtccattca
tggcttttcagtaatctctaa

KEGG   Anaerolinea thermophila: ANT_18150
Entry
ANT_18150         CDS       T01410                                 

Definition
(GenBank) putative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_18150
   00020 Citrate cycle (TCA cycle)
    ANT_18150
   00620 Pyruvate metabolism
    ANT_18150
   00650 Butanoate metabolism
    ANT_18150
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     ANT_18150
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     ANT_18150
SSDB
Motif
Pfam: POR_N POR Transketolase_C PFOR_II
Other DBs
NCBI-ProteinID: BAJ63841
UniProt: E8N5X7
Position
complement(2044924..2046771)
AA seq 615 aa
MPLTEQLETVSSPQVNPEVINDFAITFCTVNGSGSATANLTVMRALFKMGIPVSGKNIFP
SNIQGLPTWYTIRVSKDGYVGRVEKDNIIVAMNPATFVKDLEFLVPGGVVLYNEDIKTPP
NRDDLIYYPMPVKQLIKTVEIPSQLRDFVSNMVYVGILSYLLDIDLNAVHAALEFHFKGK
KTPIESNMAVIQNAYQWAKENLQKKDPYKVAPMDKTKGKLLADGNTAAALGSIYGGVQFV
SWYPITPASSLPEALIEYLPKLRTDPETGKQNYVVVQAEDEIAAIGMLVGAGWAGLRAMT
ATAGPGLSLMSEYMGLAYFAEVPLVVWDVQRVGPSTGLPTRTAQGDITEVYFMSHGDTQY
IQLFPGNINECFEFGWRAFDIAERLQMPVVVMSDLDLGMNNWMCDPFEYPQTPMDRGKVL
WEKDLEAILQKNEGKWGRYLDVDGDGIPYRTLPGNLHPKSAYFARGTGHDEFAGYSEDPE
VWERVLNRLAKKWETAKQYIPENVLYPRDGAEIGIIAVGSTEPAILEALDLLEQEGIKAD
YLRIRAFPLKEDVQKFIESHQRIYVVEINRDGQLRQILMINYPQNAGKLIQVSRINGLPL
SARWIRDEILAQERK
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccactcacagaacaacttgaaacggtttcctctcctcaggtcaatccggaagtgatt
aatgattttgctatcaccttctgtacggtgaatggttccggaagtgccacagccaatctc
acggtgatgcgtgccctgttcaagatgggaattccggtctcgggtaagaatattttcccg
tcgaatattcaggggttgcccacctggtacactattcgggttagcaaagatgggtatgtc
ggacgggttgagaaggacaacattattgtggctatgaatcccgccacgtttgtgaaggac
ttggaatttctggtccctggtggtgtggttctctacaatgaagacatcaaaacccctccc
aatcgagacgatctcatttattaccctatgcctgtcaaacaattaattaagacggtggaa
atcccttcccagttgcgtgattttgtctctaacatggtatatgtcgggattctctcttat
ttgctggatatagacctgaacgcggtgcatgctgcactggagtttcacttcaagggcaaa
aagacaccgatagagagcaacatggcggttattcaaaacgcctatcaatgggcaaaagaa
aacctccagaagaaagatccttacaaagttgctccaatggataagacgaagggaaaactc
cttgcagacggcaatacagcggcggcattggggagtatttatggaggagtacagtttgtt
tcctggtatcccatcactccagcatcttctcttccagaggcattgattgaataccttccc
aaactgcgcaccgacccggaaaccggcaaacaaaattacgtggttgtacaggcagaagat
gagattgctgctattggcatgctggtaggcgctggctgggctggcttacgtgccatgacg
gcaaccgctggccccggtttgagcctgatgagcgaatatatggggctggcgtattttgcc
gaggttccactggtcgtctgggatgttcagcgagtgggaccgagcaccggtttacccacc
cgcactgctcagggagatattacggaagtctattttatgagccatggtgacactcaatac
atccagctattcccaggaaacatcaatgagtgtttcgagttcggctggagagcgttcgac
attgccgagcgcctgcaaatgcctgtagtggtgatgagtgaccttgatcttggaatgaac
aactggatgtgcgacccatttgagtatccccagactccaatggaccgggggaaggttttg
tgggaaaaagacctcgaagcaattcttcagaagaatgaggggaagtggggaaggtacctg
gacgtagatggtgacggcatcccttaccgtactcttcccgggaatctgcatcccaagagc
gcctattttgctcgcggtaccggacacgatgaatttgccggttactccgaagatccagaa
gtttgggagcgcgttcttaatcggctggcaaagaagtgggaaacggcgaaacaatatatt
ccagagaacgtgctttatcccagagatggtgcggagattggcatcatcgcggtggggtca
accgaaccagccattttagaggcgctggacttgctggaacaggaaggaattaaggcagat
tatctccgcatccgggctttccctctcaaagaggacgtacaaaaatttatcgagtctcac
cagcgaatctatgttgtggaaatcaatcgagatggacaattacgacagattttgatgatc
aattaccctcagaatgccgggaaactcattcaagtttccaggattaacggtttgccctta
agtgcgcgctggatccgagatgagattttggcacaggaaaggaaataa

DBGET integrated database retrieval system