KEGG   Anaerolinea thermophila: ANT_05450
Entry
ANT_05450         CDS       T01410                                 

Gene name
rbsB
Definition
(GenBank) ribose ABC transporter substrate binding protein precursor
  KO
K10439  ribose transport system substrate-binding protein
Organism
atm  Anaerolinea thermophila
Pathway
atm02010  ABC transporters
atm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:atm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ANT_05450 (rbsB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ANT_05450 (rbsB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atm02000]
    ANT_05450 (rbsB)
Transporters [BR:atm02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    ANT_05450 (rbsB)
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 PucR ATPgrasp_N SBP_bac_3 ZnuA
Other DBs
NCBI-ProteinID: BAJ62579
NITE: ANT_05450
UniProt: E8N1H4
Position
586410..587342
AA seq 310 aa
MKRSIVYLLLAFVLVLAACTPAAQTATQAPQQGGEITLGLVLSTLNNPFFVTLRDGAQKA
ADAAGVKLIVVDAQDDSAKMTAGIEDLINKKVSALLINPTDSDAVVPAIQKANEAGIPVF
TVDRGSNGGTVVSHIASDNVAGGKMAAEFLCKAIGGKGNVVELQGIAGTSAARDRGQGFN
EYMSTSCKDAVIVAQQTADFNRDKGLKVFENILQAQPEIAGVFAHNDEMILGAIQAAEAA
GRTGIVFVGFDAIDDAVQAVKDGKLAATVAQQPAVMGQMAVETAVKYLKGEKVDASIPVP
LNLVTKDTVK
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaaacgttcaatcgtctatctgcttctggctttcgtgctggtgctggcggcatgcacc
ccggcggcgcaaaccgctacccaggcgcctcagcagggtggtgaaatcaccctcgggctg
gttctctcgaccctgaacaaccccttcttcgtcaccctgcgggatggcgcgcagaaagcc
gccgacgccgcgggcgttaaactcattgtggtagatgcgcaggatgactccgccaagatg
accgcgggcatcgaagacctcatcaacaagaaggtttcggcactgctcatcaaccccacc
gactccgacgcagtcgtccccgccattcagaaagccaatgaagccggcatccccgtcttc
accgtggatcgcggctccaacggcggaacggtggtcagccacatcgcttcggataatgtg
gcgggcggcaagatggcggcagaattcctctgcaaagccattggcggcaagggcaacgtg
gtcgaactgcagggcattgccggtacttctgccgcgcgcgaccgcggacagggcttcaat
gagtacatgtccacgtcctgcaaggacgccgtcattgttgctcagcagaccgctgatttc
aaccgtgacaagggcttgaaggttttcgagaacatcctgcaggctcagccggagatcgcc
ggtgtgtttgcgcacaacgacgaaatgattctgggcgccattcaggcggctgaagcggct
ggacgcacgggcatcgtcttcgttggcttcgatgccattgacgacgccgtccaggcagtc
aaggatggcaaactcgccgctaccgtggcgcaacagcccgcggtgatggggcagatggca
gtggaaaccgccgtcaagtacctcaagggcgagaaagtggatgcttccatccccgtaccg
ctcaatctggtcaccaaagacacggtgaaataa

DBGET integrated database retrieval system