KEGG   Anaerolinea thermophila: ANT_12180
Entry
ANT_12180         CDS       T01410                                 

Gene name
gltA
Definition
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00630  Glyoxylate and dicarboxylate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
atm01210  2-Oxocarboxylic acid metabolism
atm01230  Biosynthesis of amino acids
Module
atm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_12180 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    ANT_12180 (gltA)
Enzymes [BR:atm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     ANT_12180 (gltA)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BAJ63252
UniProt: E8N488
Position
1363931..1365274
AA seq 447 aa
MKMIEAITEQLPAWRERVNRLRTQFGSLKVCDVTVEQIYGGIRGVQIQVSDISYVDPYEG
IRLRGYTIPEVLEYLPKKPGSDFPLVGGLYYLLMTDRLPNEAEADEVEQEWASRSQIPEH
VYQVIRQFPRDTHPMTLFSVAIMALQPSSQFASKYAEQMFTSEGLPKGDYWKYYLEDSMN
LIAKLPGIASFIYNYKYRNEEIVSYSPELDWSANFARMIGKAEDLRYQDLCRLFFVIHSD
HEGGNVSAHTSYLVSSALSDVYLSCAAGMNGLAGPLHGLANQECIRWVLQVREAFGGHVP
GKEELTDHLRRQLQAGKLIPGYGHAVLRVTDPRFTVQYEFAKKYISNDPNIELIGRVFEV
LPPILAENGKVKNPYPNVDAINGALQYHYGVKEFDFYTVLFGMSRILGLTAHIVWGRILG
KPIERPKSLTTAMLEQLAEKSLQSLER
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaagatgattgaggcgattaccgagcaattacccgcatggcgggagcgggtaaaccgt
ttgcgcactcagtttggttctttgaaagtgtgtgatgttaccgtagagcaaatttacggg
ggcattcggggcgtacagattcaggtcagcgatatttcttatgtggatccctatgagggg
attcggttgcggggctacaccattccagaggtgcttgaatacctgccgaaaaagccggga
agcgacttccctctggtaggcggtttgtactatttgctgatgacggatcggttgccgaat
gaggcagaagcggatgaagtggagcaggaatgggcgtcgcgcagtcaaattcccgaacat
gtctatcaggttattcggcagttcccaagggatacccatcccatgacgctgttttccgtg
gcgattatggcacttcaaccttcctcacagttcgccagtaagtatgcggagcaaatgttt
acttccgaaggtctgcccaaaggcgattactggaagtactacctggaagacagtatgaac
ttaatcgccaagttgcccgggattgcctcgtttatttacaactataaatatcgtaatgag
gaaattgtctcttattcacctgaactggattggagtgctaactttgcccgaatgattggc
aaggcagaggatctccgttaccaggatttgtgtcgcctgttctttgtgattcattctgat
catgaaggcggaaatgtcagtgctcatacttcttacctggtcagttctgcactttcggat
gtctatctttcctgtgcagcgggtatgaacggtttggcagggccgttgcacgggctggca
aatcaggaatgcattcgctgggtgttgcaggtgcgggaggcttttggaggtcatgttcct
ggtaaagaagaactgacggatcacctgcgcaggcaactccaggcaggcaaactgattccg
ggatatggacatgcagtgttacgggtgactgatccgcgtttcactgtgcagtatgaattt
gccaaaaagtacatttcgaacgatcccaatatcgagttaatagggcgagtatttgaggtg
cttccgcctattctggcagagaatggtaaggtcaagaatccatacccgaatgtagatgcc
atcaatggggcgttgcagtatcactatggtgtaaaagaatttgatttttataccgtattg
tttgggatgagtcgcattctggggttgactgcccatattgtctgggggcggattctggga
aaacccattgaacgccctaaatcgttgaccaccgccatgctggagcagttagccgaaaaa
tctctgcagtctttggaaaggtaa

DBGET integrated database retrieval system