KEGG   Anaerolinea thermophila: ANT_13160Help
Entry
ANT_13160         CDS       T01410                                 

Definition
(GenBank) hypothetical membrane protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bactofilin Mito_carr
Motif
Other DBs
NCBI-ProteinID: BAJ63348
NITE: ANT_13160
UniProt: E8N4I4
Position
1477471..1478436
Genome map
AA seq 321 aa AA seqDB search
MNIKFRWIGFAVVVVFLFALSGCVSTTSVFSGNGAVIGQSFILREGETWDQDLSIIGGSA
VLEKGSVVNGDVALIGGTLLVDGTVTGDISAMGGVISLGSHAVVEGDIVTLGANLNRDTG
SVVKGQFQNDFPSFSFPVQPVTPRFGIFDTLMNIFWRVFQAFALGALAVLVALFMLQPLE
RVGTTMQSTPVQSGVVGFLTFLVGLGVLLVMAITIIFLPLSLLGILALGLAWIYGWLATG
LLTGEKIAELFHTSWSGPVSAGVGTLVLSLMANLLGAIPCVGWMIPFVVTMIGLGAVILS
RFGTQKYPVPVPVVPSSSAME
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaaattcagatggattggatttgcggtggtggttgtctttctctttgccctc
tcagggtgtgtgtcaacaacttctgtgttctccgggaacggagccgtgattgggcaaagt
tttatcctgagagaaggagaaacctgggatcaggacctttcgattattgggggttctgcg
gtactggaaaagggttctgtggtaaacggagatgtcgcattgattggcgggaccctactc
gtggacgggacggtcaccggggatatcagcgcgatggggggggtaatctccctgggcagc
catgctgttgttgagggggacattgtgacgctcggagccaatcttaaccgcgacaccggt
agtgtggtgaaggggcagtttcagaatgattttccatctttctctttccctgtccagccg
gtgacgccacggtttgggatcttcgacaccctcatgaatatcttctggcgggtgtttcaa
gcctttgccctgggggcgcttgcggtgctggttgctttgttcatgctccagcctttagag
cgggtaggaacgacgatgcaatccacccctgttcaatcaggtgttgtcgggtttctcact
ttcctggtggggttgggggttttgctggtgatggctattaccattattttcctgccattg
agtttgctgggcattctagcgttgggactggcatggatttatggctggcttgctacagga
ctgctgacaggcgagaagattgccgaactctttcacacttcatggagtgggcctgtgagt
gcgggggttggaacccttgtgctctcgttgatggcgaacctgttgggggcaatcccctgt
gtgggctggatgatcccctttgtggtaaccatgatagggttaggcgcagtgattctctcc
cgctttgggacacaaaaataccctgtgcctgttcctgttgtaccgtcatcatctgctatg
gaatga

DBGET integrated database retrieval system