KEGG   Anaerolinea thermophila: ANT_13210Help
Entry
ANT_13210         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW
Motif
Other DBs
NCBI-ProteinID: BAJ63353
NITE: ANT_13210
UniProt: E8N4I9
Position
complement(1482565..1483890)
Genome map
AA seq 441 aa AA seqDB search
MAPIRTIIMGAAGRDFHNFNVFFRGNPEYEVVAFTATQIPNIEGRVYPAELAGPKYPKGI
PIYPESDLVRLIKELKVDQVVFAYSDVPHEYVMHKASTVLAAGADFRLMGTKATMLKSSK
PVVAVCAVRTGSGKSQTTRRVSLILRELGYKVAAIRHPMPYGDLVKQAVQRFETYADLDK
HECTIEEREEYEPHLDNGVIVYAGVDYEKILRQAEQEVDIILWDGGNNDFPFYVPDLYIV
VADPHRPGHELAYHPGETNVRAADVFVLNKVDTARPEDVIKVRESLYAVNPNAIFIEAAS
PLFVENPGAIRGKRVLVVEDGPTLTHGEMAYGAGWVAARRFGAAEIVDPRPFAVRSILET
YKKYPTTGAILPAMGYGEAQMKDLEETINRSDVDLVISATPIDLTRVIKVQKPIQRVRYE
LQEIGKPDLMDILSEKFGKKK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaattcgaaccatcatcatgggcgctgctggaagagacttccataacttcaat
gtttttttccgcgggaatccggaatacgaagtcgttgccttcaccgcaacccaaattccc
aatattgaaggcagagtttaccctgctgaactggctgggccaaaataccccaaagggatt
ccaatttaccccgaaagcgatctggtgcggttgattaaggaactcaaagttgatcaggtc
gtattcgcttacagcgatgtcccccatgaatatgtcatgcacaaagcctctactgtgctt
gcagcaggtgccgatttccgcctgatgggtaccaaagccaccatgctgaaatcctcgaaa
ccagttgtggcggtttgtgccgtacgtaccggctcagggaagagccagaccacccgtcgt
gtttctctgattttgcgcgaattgggatacaaagttgccgccattcgccaccccatgcct
tacggcgatctggtgaagcaagccgtgcaacggtttgagacctatgctgatctggacaag
cacgaatgcaccattgaggaacgcgaagaatacgaaccacaccttgacaacggcgtgatt
gtttacgctggtgtagattacgaaaaaatcctgcgccaggcagagcaggaagtggatatc
attctgtgggatggtggcaacaacgatttccccttctatgtgcccgatctctacatcgtg
gttgcggacccgcatcgccctggacacgaactggcttatcaccccggcgaaaccaatgtc
cgcgcagcagatgtgttcgtattgaacaaagtggatactgcacgtcccgaagatgtcatc
aaagtgcgtgagagtctgtatgcagtcaacccgaatgccatctttattgaagcggcttca
cccttattcgttgaaaatcctggggctatccgtggcaaacgcgtgctggtcgtcgaagat
ggtcccacgctgactcatggcgagatggcttacggcgctggctgggtagcggctcgacgc
ttcggcgcggctgaaattgtggacccgcgcccctttgctgtgcgcagtatcctggaaacc
tacaagaagtaccccaccaccggcgcgattctgcccgctatgggttatggtgaagcccag
atgaaggatctggaagaaaccatcaaccgctccgatgtcgacctggtcatcagcgccacc
cccattgacctgacccgggtgattaaggtgcaaaagcccatccaacgggtgcgctatgaa
ctgcaggaaattggcaaacccgacttgatggacatcctgtctgaaaagttcggcaagaag
aaataa

DBGET integrated database retrieval system