KEGG   Anaerolinea thermophila: ANT_13440Help
Entry
ANT_13440         CDS       T01410                                 

Definition
(GenBank) putative oxidoreductase
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Rieske_2
Motif
Other DBs
NCBI-ProteinID: BAJ63376
NITE: ANT_13440
UniProt: E8N4L2
Position
1509078..1510061
Genome map
AA seq 327 aa AA seqDB search
MIPNQWYVVLESREVRVGRPVGAVRMGEKMVFWRRKDGKVVCMADRCPHLGASLSRGKVV
EDHLACPFHAFEFDPGGACVYIPALGRNTPPPKAMRIKSYPTYEAHGFIWIYWGEPQGEL
LPPKFFDIDETFSYAGYRQLWPVHYSRMVENQLDVMHLPHVHTDTIGRGRKVVVDGPLAR
VEDGVLKVWVFNRKDDGTPPRRADELPTPSRPPFLEFIFPNLWQNRISSDYRIVVAFVPV
DEEHGMFYLRQYQRIVRIPILREIVNWIGVLGSHHIAEQDRRVVSTQLPKKSALRGEDKP
VQGDHAILTYRRYREELIEKARSNGAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgattccaaaccagtggtatgttgtgctggaatccagagaggttcgggtgggaaggccg
gtaggggcggttcggatgggggagaagatggttttctggcgccgtaaggatggaaaggtg
gtttgcatggcagaccgttgcccgcatttgggagcgagtttgtccagaggaaaagtagtc
gaagaccatttggcttgcccattccatgcctttgaatttgatcccggtggagcgtgtgtt
tatattccagcgctggggagaaatactcctcctcctaaagcgatgcggataaagtcgtat
cccacttatgaagcccatggctttatctggatttattggggggaacctcaaggggaactt
cttcctccgaagttttttgacattgatgagactttctcttacgctggataccgccaattg
tggcctgtacactattcgcgaatggtagagaaccagctggatgtgatgcatttgccccat
gttcataccgatactattggcagaggaagaaaagtggtggtggatggccctcttgccaga
gtggaagacggggttctaaaagtgtgggtgttcaatcgtaaggatgatggaactccaccc
cgacgggctgacgaacttcccacgcccagccggcctccctttttagaattcattttcccc
aatctctggcaaaaccgcatcagttcagactatcgcatcgttgtagcgtttgtcccggta
gatgaggaacatggtatgttctacctgagacagtatcaacggattgtccgtattcctata
cttcgtgaaattgtcaactggattggggtgctcggcagccatcacattgccgagcaggat
cgtagagtcgtcagtacgcaattgcctaaaaaatctgccttgcggggcgaagataagcct
gttcagggggatcatgccatactgacgtaccgaagatatcgggaagaattgatagaaaaa
gccaggagtaatggtgcaaaatga

DBGET integrated database retrieval system