KEGG   Anaerolinea thermophila: ANT_13520Help
Entry
ANT_13520         CDS       T01410                                 

Definition
(GenBank) methyltransferase
  KO
K00571  site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
atm  Anaerolinea thermophila
Brite
KEGG Orthology (KO) [BR:atm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:atm02048]
    ANT_13520
Enzymes [BR:atm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     ANT_13520
Prokaryotic defense system [BR:atm02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    ANT_13520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_N4_Mtase Cons_hypoth95 MethyltransfD12 MTS Methyltransf_25 Met_10 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: BAJ63384
NITE: ANT_13520
UniProt: E8N4M0
Position
1517358..1518245
Genome map
AA seq 295 aa AA seqDB search
MTWIRRVYFGDNLSILRRLPSESVHLIYIDPPFNTGKEQSRTRLRVVQSDTGNRRGFGGR
TYESIPIDEKAYPDDFDDYEAFLVPRLEEAYRILTPNGSLYFHIDYREVHYCKIWLDRIF
GRDCFLNEIIWAYDYGGKPKNRWPAKHDNILFYVKDPNHYTFNVDAIDREPYMAPGLVGP
EKAARGKLPTDVWWHTIVGTNSKEKTGYPTQKPVGVIDRIIKASSNAGDVVMDFFAGSGT
VGESCLKLNRQFILIDNHPEAIHVMRQRFAGVEGIEWINAFNTSSGDTQSLDPFE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacctggattcgccgtgtttattttggggataatttatctatactaagacgacttccg
tcggagtcggtgcacttaatttatattgacccaccctttaataccggaaaagagcaatcg
cgtacgcgtttgagagttgttcaatccgatactggaaatcggcgagggtttggcggaaga
acctatgaaagtattccgattgacgaaaaagcatatccggatgattttgatgactatgaa
gcctttcttgttccccgcctggaggaagcctatcggattctaactcccaatgggagcctg
tactttcacatagactatcgtgaggtccattactgtaaaatctggttagatcggattttt
ggacgggattgttttttaaacgaaatcatttgggcttatgattatggaggaaagcctaaa
aatcgctggcctgccaagcatgacaacatccttttttacgtcaaagacccaaatcattac
acctttaatgttgatgctattgatcgtgagccgtatatggcacctggtctggtgggccct
gagaaagcggcgcgcggcaaactcccgacagatgtgtggtggcatacgattgtgggaaca
aacagcaaggagaaaaccggctatcctactcaaaagcctgtgggggtaattgatcggatt
attaaggcatcgtcgaatgcaggggatgtggtgatggacttttttgccggtagcggtact
gtgggtgaaagttgtctgaaattgaaccgtcagtttattttgattgataaccaccccgaa
gctattcatgtcatgcggcaacgatttgccggggtagaggggattgaatggataaatgcc
ttcaacacatcaagcggtgacactcaatccttagacccttttgaataa

DBGET integrated database retrieval system