KEGG   Anaerolinea thermophila: ANT_13600Help
Entry
ANT_13600         CDS       T01410                                 

Definition
(GenBank) response regulator receiver protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Hpt
Motif
Other DBs
NCBI-ProteinID: BAJ63390
NITE: ANT_13600
UniProt: E8N4M6
Position
1526308..1527108
Genome map
AA seq 266 aa AA seqDB search
MEHNSKIPVLLVEDNPVNQRVAMMMLQKLGFQPDFAGNGQQALKMVKEKALLESYPYKVV
FLDIFLPDIDGSEVCRRIRAELPLKDQPFIVALTADESQENLKHYIDDGMDAILIKPLKM
SELQEVIDIFQKKNLILKAQSEEIDWRNTGEVLHLPTLRKWQEMLGGKDAFRNVVSIYIK
DARLLFEGIERGVAEDNWKLVHRNAHTLKSTSANLGALGLASVLEEVELIAYENLTGDFP
RSVTDLICQARDCLKKVLQELETYIQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaactctaaaatccccgttcttttggttgaggacaatccggtcaatcaacgg
gttgcaatgatgatgttgcaaaaactggggtttcagcctgactttgccggcaatgggcaa
caggccctgaaaatggttaaggaaaaggctctcctggaaagttatccttataaggtagtg
tttcttgatatttttttacctgatatagacggttcagaagtatgtcgcagaattcgtgca
gaacttcccctgaaagatcagccatttattgtggctcttactgcggatgaatctcaggaa
aatctcaagcattacattgacgatggtatggatgccatattaatcaaaccgttgaaaatg
agcgagttacaggaagttatagatattttccagaaaaaaaatcttatcttaaaggcacaa
tccgaagaaatagattggagaaacactggcgaagtccttcatctgccaaccttacggaaa
tggcaggaaatgctgggagggaaggatgcgtttcggaatgtagtcagtatttatataaaa
gatgcacgcttgttattcgaaggcattgagagaggggtagcagaagataactggaaactt
gtgcatcgaaatgcccataccctgaaatccaccagtgccaatctgggggctttgggcttg
gcatcggtgctggaggaagtggaactaattgcttacgaaaatctgaccggtgatttccct
cgttctgtgaccgacctgatttgtcaggcacgagattgtttgaaaaaagtacttcaggaa
ttggaaacatacattcaataa

DBGET integrated database retrieval system