KEGG   Anaerolinea thermophila: ANT_13670Help
Entry
ANT_13670         CDS       T01410                                 

Gene name
araB
Definition
(GenBank) ribulokinase
  KO
K00853  L-ribulokinase [EC:2.7.1.16]
Organism
atm  Anaerolinea thermophila
Pathway
atm00040  Pentose and glucuronate interconversions
atm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ANT_13670 (araB)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.16  ribulokinase
     ANT_13670 (araB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_C FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAJ63395
NITE: ANT_13670
UniProt: E8N4N1
Position
complement(1532090..1533766)
Genome map
AA seq 558 aa AA seqDB search
MPKYAIGVDFGTESGRAVLVDITNGQEIATAVYTYANGVIDEVLPESNLRLEPDWALQDP
EDYIRVFQNAIPAVLQQSGVNPADVIGIGIDFTACTMLPTLKDGTPLCVLPQYRNRPHAW
VKLWKHHAAQPEANRLNEIATELGYSFLNRYGGKISSEWFFPKVWQILNEDPEIYFAAER
FIEAADWVVWQLTGEETRNSCTAGYKAIWSKQEGFPPREFFRALDPRLENIVDEKMSRQI
VSIGQCAGYLTEEAARWTGLKPGTAVAVANVDAHVSVPASTVTEEGKMVMIMGTSICHMV
LSRSEHFVPGICGYVEDGIIPGIFGYEAGQSCVGDHFGWFVEQCVPEHYQQEARQRGVDI
HALLEEKAAQLKPGESGLLALDWWNGNRSVLVDVDLTGMMLGMTLLTKPEEIYRALIEAT
AYGTRVIIETFVHHGVPVNELIATGGLPDRNKLLMQIYADVTGREIRVAAAHQTPALGSA
MFGAVAAGKSAGGYDDIFEAAKHMAHLRDEVYRPIPEHQQVYDKLYQEYLILHDYFGRGA
NDVMKRLKALKASIRGKV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagtatgccattggcgtagattttggcaccgaatcgggacgtgcagtgctggta
gatatcaccaacggacaggaaatcgctacagcagtatatacctatgcgaatggtgtaatc
gacgaggttcttcctgagtccaacctccgcctagaacctgactgggcattgcaagacccg
gaagattacatcagagtgtttcaaaatgccattcccgccgttcttcaacaaagcggggta
aatcccgccgatgttattggaatagggattgactttaccgcgtgtaccatgcttcccacc
ctgaaagatggcacccctctttgcgttcttcctcaataccggaatcgcccgcacgcatgg
gttaaactatggaaacaccacgccgcacagcctgaagccaatcgcttgaatgaaatagcc
accgaactcggatattctttcttgaatcggtatggagggaaaatcagttcggagtggttt
tttccaaaggtttggcaaatcttgaacgaagatccggaaatttattttgctgcagagcgt
ttcattgaagcggcagactgggtagtctggcaactcacaggcgaagaaacccgcaattcc
tgcactgctggctacaaagccatctggtccaaacaggaaggcttccctcccagagaattt
ttccgtgccctcgacccacgcctggaaaacattgtagatgaaaaaatgtcccggcagatt
gtctccattggacaatgtgcggggtacctgactgaagaagccgcacgctggaccggactg
aagcctggaactgctgttgccgtggcaaacgttgatgcccatgtctcggtacctgcctca
actgtgacagaagaaggcaaaatggtgatgatcatgggaacttcgatttgtcacatggtc
ttatcacgaagtgagcattttgttccagggatttgcggatacgtggaagacggaattatt
ccaggcattttcggttatgaagccgggcaatcctgtgtgggagaccattttgggtggttt
gtggaacagtgtgtaccagaacactatcagcaggaagcccgccagcgaggagtggacatt
catgccctcttagaagaaaaagccgcccagttgaaacctggcgaaagcggtttgctggct
ctggactggtggaacgggaaccgctccgttctggtggatgttgacctgaccggtatgatg
cttggcatgaccctgttaaccaaaccggaagaaatttaccgcgccttgatcgaagccact
gcctatggtactcgggtaatcattgagacatttgtccatcatggggttccagttaacgaa
ttgattgcgacgggggggttacccgaccgcaacaaattgctgatgcaaatttacgcagat
gtcaccgggcgagaaatccgcgttgctgccgcacatcaaaccccagcgttgggttcagcc
atgtttggcgccgtagccgccggaaaatcggcaggaggatacgatgatattttcgaggca
gcaaaacacatggctcacctgcgtgatgaagtataccgtcctatcccggaacatcagcaa
gtgtacgataaactttatcaggaatacttaattctccacgattatttcgggcgaggcgca
aacgatgtcatgaaacgattgaaagccttgaaagcctccatcaggggaaaggtatag

DBGET integrated database retrieval system