KEGG   Anaerolinea thermophila: ANT_13780Help
Entry
ANT_13780         CDS       T01410                                 

Gene name
atpG
Definition
(GenBank) ATP synthase gamma chain
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
atm  Anaerolinea thermophila
Pathway
atm00190  Oxidative phosphorylation
atm01100  Metabolic pathways
Module
atm_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_13780 (atpG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:atm00194]
    ANT_13780 (atpG)
Photosynthesis proteins [BR:atm00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   ANT_13780 (atpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt
Motif
Other DBs
NCBI-ProteinID: BAJ63406
NITE: ANT_13780
UniProt: E8N4P2
Position
1543838..1544740
Genome map
AA seq 300 aa AA seqDB search
MASTREMRLRIRSVKNLSQVTKALETVSASRVRKAIQANNSSKPYAEKAWKVLVHLARQP
GHDALHPLLADRPVVRRALVILVTSDRGLAGSYNANIFRHTLHEFSQKPYPVDFVAVGRK
GRDLLLRRRKNVIAEFSDLPSPPLYREVAPIASLAIEDFEKQKYDEVYICYTQFINMMRY
EPVTRRLLPLKILYKDEAPDIHTLDATHRTHSVFSFEPDEGEVLSNIVPHFTGIQIFQAI
LSAQASEHAARMIAMRNATESAQELIQSLQLEYNKLRQTLITNEMLDIAGGANALAQEKE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctacgcgagaaatgagactgcgtatccgcagtgtcaagaatctttctcaagtc
accaaggctctggaaacggtcagtgccagccgggtacgcaaagcgatccaggcaaataat
tccagcaaaccctacgccgaaaaagcctggaaagttcttgtgcatctggcgagacaaccc
gggcatgatgcgcttcatccgttgctggcagaccgtcctgtagttaggcgcgcgctggtt
attctggtgaccagtgatcgagggttggctggctcttacaatgccaatatttttcgtcat
accctgcatgaattcagtcagaagccttacccggtagattttgtggctgtaggcagaaag
ggaagggatttacttctgcgacgcagaaaaaatgtaattgcagagttcagcgatttacct
tctccgcctttgtacagagaagtagctcctattgccagtttggcgattgaggacttcgag
aaacaaaagtatgatgaggtgtatatctgctatacccagtttatcaatatgatgcggtat
gagccggtaacccgcaggttgcttcccttgaaaatcctctataaagatgaagcccccgat
atccatacgctggatgcaactcatcgcactcattcggttttctcttttgaaccggacgaa
ggggaagttctgagtaatattgtgcctcactttaccgggattcaaatttttcaggcgatt
ttgtcggcacaagccagtgagcatgcggcgcgcatgattgccatgcgtaacgctacggag
agcgcgcaggaattgattcaatcgcttcaacttgaatataacaaattgcgtcaaacactc
attacaaacgaaatgctggatattgctggtggggcaaacgccctggcacaggaaaaagaa
taa

DBGET integrated database retrieval system