KEGG   Anaerolinea thermophila: ANT_13800Help
Entry
ANT_13800         CDS       T01410                                 

Gene name
atpC
Definition
(GenBank) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
atm  Anaerolinea thermophila
Pathway
atm00190  Oxidative phosphorylation
atm01100  Metabolic pathways
Module
atm_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_13800 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:atm00194]
    ANT_13800 (atpC)
Photosynthesis proteins [BR:atm00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   ANT_13800 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-ProteinID: BAJ63408
NITE: ANT_13800
UniProt: E8N4P4
Position
1546166..1546582
Genome map
AA seq 138 aa AA seqDB search
MPIRCEIVSQDRVVFAEDVDMVILPGGGGQMGVLPNHSPVLTTLQYGIIHVKKQGEEYYF
TVAGGFAEVQPDQVTVLADAAENVEEINLQRAEEARRRAENLLKQGIPEDTDEYLNIQAA
LRRSNLRIEAVKRYRRHH
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaatccgctgtgaaattgtttcgcaggatcgggttgtctttgcagaagacgtggat
atggtgattcttccgggagggggtggacaaatgggggtgttaccgaaccactctcccgta
ctaaccaccttgcaatatggcatcatccatgtgaaaaagcaaggggaagagtattatttt
actgtggcggggggctttgccgaggtacagcctgatcaggtaaccgttctggcggatgcc
gccgaaaatgttgaagaaatcaatcttcagcgagccgaagaggcgcggcgcagggcagag
aatttgctcaaacagggcataccggaagataccgacgaatatcttaacatccaggctgcg
ttgcgccgttctaatctgcgtattgaagcggtcaaaagataccggcgtcatcactaa

DBGET integrated database retrieval system