KEGG   Anaerolinea thermophila: ANT_13970Help
Entry
ANT_13970         CDS       T01410                                 

Gene name
parB
Definition
(GenBank) chromosome partitioning protein ParB
  KO
K03497  chromosome partitioning protein, ParB family
Organism
atm  Anaerolinea thermophila
Brite
KEGG Orthology (KO) [BR:atm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:atm03000]
    ANT_13970 (parB)
   03036 Chromosome and associated proteins [BR:atm03036]
    ANT_13970 (parB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:atm04812]
    ANT_13970 (parB)
Transcription factors [BR:atm03000]
 Prokaryotic Type
  Other transcription factors
   Others
    ANT_13970 (parB)
Chromosome and associated proteins [BR:atm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ANT_13970 (parB)
Cytoskeleton proteins [BR:atm04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   ANT_13970 (parB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc KorB HTH_Crp_2 TrmB HTH_23
Motif
Other DBs
NCBI-ProteinID: BAJ63425
NITE: ANT_13970
UniProt: E8N4R1
Position
complement(1559709..1560563)
Genome map
AA seq 284 aa AA seqDB search
MARKGGLGKGLGALIPGESPQSEGGVISLPIHQIKPNPRQPRTEINEAHLQELAESIREH
GVLQPVLVTTEPGKDGYYLVAGERRLRAAQMAGLELIPAIIRSVSEQERLELALIENLQR
EDLSPLETAEAYQKLVEEFGLRHEDIAIRVGKSREAVSNTLRLLNLSAEVKKALQSGQIS
EGHARALLGLPHEAAQNALLKVILEQGLTVRQTEELVRKMSGERPQKRRKRGLSPELQEY
EEQLRSRFGTKVSIRHGQKGGAIVIYYFSEEEFDHLLHQFLGNS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaaggtggattgggaaaaggtttaggcgcactgattcccggggaatccccc
caaagtgaaggtggtgtgatctccctgcccattcatcaaatcaaacccaatcctcgccaa
ccccgtacagaaataaacgaagcccatttacaggaattagccgaatcgattcgcgaacac
ggagtgttacaacctgtactggtcaccacagaacctgggaaagatgggtattaccttgtt
gcgggagagagacgtctgcgggcggctcaaatggctggactggagttgattcccgcgatc
atccgttcagtaagcgaacaggaacgccttgaactggcactgattgaaaatctacaacgg
gaagacctctctccccttgagacggcagaggcgtaccagaaactggtagaagaatttggt
ttacggcatgaagacattgccatccgggtaggaaaaagccgcgaagccgtgagcaatact
ctgcgacttctcaacctctctgcagaagtcaagaaagccctgcaaagcggacaaatcagc
gaaggacatgcccgtgcattactggggttaccccacgaagccgcccagaatgccctgttg
aaagtcattctggaacagggtttgaccgtacgacagacagaagaactggtgcgaaagatg
tcgggggaacgtccgcagaaacggcgtaagcggggactttccccggaacttcaggaatat
gaagagcaattgcgttctcgctttggcaccaaagtctccattcgccatggacaaaagggt
ggagccattgtcatttactatttctccgaagaagagtttgatcatttactccatcaattt
ttggggaattcatga

DBGET integrated database retrieval system