KEGG   Anaerolinea thermophila: ANT_14040Help
Entry
ANT_14040         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_int_SAM_4
Motif
Other DBs
NCBI-ProteinID: BAJ63432
NITE: ANT_14040
UniProt: E8N4R8
Position
1567832..1568122
Genome map
AA seq 96 aa AA seqDB search
MPDCFSFLAWNIIEIYWNGGGFMENLPLSDFWDAILSRNPRLIREAFVGLDESSKTAVMA
HLEKMATESGWHPEQVKSAKAALVVIHGMNVKTRRS
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgactgcttttcttttttggcatggaatataatagaaatctattggaatggaggt
gggtttatggagaatctcccattatctgatttttgggatgctattctctctcgaaatcca
cgccttattcgagaggcatttgtaggactggatgagtcatccaaaactgcggtcatggct
catctggaaaaaatggctactgagagcggctggcatcctgaacaggttaaatctgcaaag
gcggcacttgtagtgattcatggaatgaacgtaaaaacacggaggtcttga

DBGET integrated database retrieval system