KEGG   Anaerolinea thermophila: ANT_14050Help
Entry
ANT_14050         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
atm  Anaerolinea thermophila
Pathway
atm00230  Purine metabolism
atm00240  Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ANT_14050
   00240 Pyrimidine metabolism
    ANT_14050
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     ANT_14050
    3.2.2.-  
     ANT_14050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysine_decarbox DNA_processg_A Asparaginase Urocanase
Motif
Other DBs
NCBI-ProteinID: BAJ63433
NITE: ANT_14050
UniProt: E8N4R9
Position
1568122..1568652
Genome map
AA seq 176 aa AA seqDB search
MRVTVFGGTYPKPDTLPYEEAVKLGRLLAQAGHVVISGGYMGVMEAVSQGAALAGGHVIG
VTCDEIERWRNVPKNQWVKEEWRRATLPERMITLMDEADAIIVMPGGIGTLAETALIWNR
MLIQATTPKKVILVGEGWRKAITALYEAFPEYYPNGHQEMVLFASTVEDAVKLLAS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcactgtatttggagggacatatccaaaaccggatactttaccatatgaggaa
gcggttaaactgggcaggcttctggctcaggcagggcatgtggtcattagcggtggttac
atgggggtgatggaagccgtttcacaaggtgctgcattggctggcggacatgtgattggg
gtgacctgtgatgaaattgagcggtggcggaatgttcccaaaaaccagtgggttaaggag
gagtggcgccgtgctaccctgccggagcgtatgattaccctgatggatgaagcggatgcc
attattgtcatgcccggaggaattggcacgctggcagaaacggctctcatctggaatcgc
atgctcattcaagccacaacgcctaaaaaagtaattctggttggggagggctggcggaaa
gccattacagccctgtatgaggcatttcccgagtattatcccaacggacatcaggaaatg
gtgttgtttgcttctactgtggaggatgctgtaaaacttctggcaagttag

DBGET integrated database retrieval system