KEGG   Anaerolinea thermophila: ANT_14110Help
Entry
ANT_14110         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KRAB LRRC37
Motif
Other DBs
NCBI-ProteinID: BAJ63439
NITE: ANT_14110
UniProt: E8N4S5
Position
1575467..1575652
Genome map
AA seq 61 aa AA seqDB search
MANPSEPKTETIAETENYIAWKADEPDGETTYHIELNNVTVHFFEEEWEEFLQLAKLLIK
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacccatcagaacccaagactgaaaccattgcagaaaccgaaaattatattgcc
tggaaggcggacgagccggatggtgaaaccacctatcacattgaacttaacaatgtcacg
gtgcatttttttgaagaagaatgggaagagtttctgcaattggcgaagttgttgataaag
aagtag

DBGET integrated database retrieval system