KEGG   Anaerolinea thermophila: ANT_14170Help
Entry
ANT_14170         CDS       T01410                                 

Gene name
hpt
Definition
(GenBank) hypoxanthine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
atm  Anaerolinea thermophila
Pathway
atm00230  Purine metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANT_14170 (hpt)
Enzymes [BR:atm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     ANT_14170 (hpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: BAJ63445
NITE: ANT_14170
UniProt: E8N4T1
Position
1580505..1581080
Genome map
AA seq 191 aa AA seqDB search
MWDYREFLGEVLIDSDTLQRRIQELGEQISKDYEGKKLLLVCILRGGVMFLTDLMRSIRI
PHAIEFMAVSSYGVGGRHSSGQVRITFDLNTDISEWDVILVEDIIDSGHTLHSVLELLSI
RQPKSLSVCALLDKSERREVEIPLKYIGFEIPNKFVFGYGLDIDDFYRNLPFIGVVNLEK
YNALIHQQEKE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtgggattatcgtgaatttcttggagaagtgctgattgactccgacactttacaaaga
cgtattcaggaattaggtgaacagattagcaaggattacgaaggaaagaaacttttgctg
gtttgcatccttcggggtggagtcatgttcctaaccgatctcatgcgctctattcgaatt
cctcacgctattgagttcatggcggtctcttcgtatggagtaggtgggcgtcattcttcg
ggacaggtaagaattacatttgatttgaacaccgatatttctgagtgggacgtaattttg
gtggaagatattatcgacagtgggcatacgctccattctgtgctggaacttctttccatt
cgacagccaaaaagcctgagcgtatgcgctttgctggacaaatcggaaaggcgggaggta
gaaatcccgttgaaatatataggctttgagattcccaataaatttgtttttggctacggt
ttggacattgatgatttctatcgaaatcttccttttatcggtgtggttaacctggaaaaa
tacaatgctttgattcatcagcaggagaaggagtga

DBGET integrated database retrieval system