KEGG   Anaerolinea thermophila: ANT_14260
Entry
ANT_14260         CDS       T01410                                 

Gene name
pdhA
Definition
(GenBank) putative pyruvate dehydrogenase E1 component alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_14260 (pdhA)
   00020 Citrate cycle (TCA cycle)
    ANT_14260 (pdhA)
   00620 Pyruvate metabolism
    ANT_14260 (pdhA)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ANT_14260 (pdhA)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: BAJ63454
UniProt: E8N4U0
Position
1590126..1591085
AA seq 319 aa
MEKDEYFRMYREMVVIRRLEERSAELYQQGKIGGFLHLYIGQEAVSTGLISARKPQDRVI
TAYRDHGVAINCGLSAREVMAELLGKATGCSKGKGGSMHLADVTKNFWGGHAIVGAHLPI
ATGLALGDAYKGEKNVTICMFGDGATNIGFFHEALNMSKIWNLPVLWVCENNQYGMGTAV
ERASAVSEIIQKAQAYAMPSRRVDGMDVMAMRQAAEEMIEAIRNGAGPMLMEAMTYRFRG
HSMGDPERYRKPEEVHRYQENDPIGIFRKYLQENGIATEEELNQLDDEAEAIVEDAVQFA
EASPEPQPHELFEHIYVEA
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaaaaagatgaatattttcgcatgtatagagagatggtagtgatccgccgcttggaa
gaacgttctgctgaattgtatcagcagggcaaaatcggcggatttctccatctttatatt
ggacaggaagcggtaagcactggcttaatttctgcaagaaaaccacaggaccgtgtgatt
accgcctaccgtgatcatggcgttgcgatcaattgtgggctgtcggcgcgggaagtgatg
gcagaacttcttggaaaagccacagggtgctctaaaggcaaagggggctcgatgcatctt
gcagatgttaccaaaaacttttggggaggtcatgccattgtgggagcccatttgcccatt
gccaccggattggcgttgggcgacgcttataagggagagaaaaatgtgaccatttgcatg
ttcggtgatggggctaccaacatcggctttttccatgaagccctgaatatgagcaaaatc
tggaatttgccggttctctgggtgtgtgaaaataaccagtacggtatgggcacggcggtt
gaacgtgcctcagcggtgtccgaaatcatccagaaagcccaggcttatgccatgcccagc
cgacgggtggatggaatggatgtcatggcaatgcgtcaggcagcggaagagatgattgaa
gccattcgcaatggggcgggcccaatgctgatggaagccatgacttatcgcttccgtgga
cactccatgggcgacccggaacgttatcgaaaacctgaagaagttcatcggtatcaggaa
aatgatcccatcggaattttccgcaagtatcttcaggagaatgggattgcgaccgaagag
gaactcaatcaactggatgatgaagcggaagccattgtggaagatgctgtccagtttgct
gaagccagtccggaacctcagcctcatgaattgttcgagcatatttacgtagaagcatag

KEGG   Anaerolinea thermophila: ANT_14270
Entry
ANT_14270         CDS       T01410                                 

Gene name
pdhB
Definition
(GenBank) putative pyruvate dehydrogenase E1 component beta subunit
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_14270 (pdhB)
   00020 Citrate cycle (TCA cycle)
    ANT_14270 (pdhB)
   00620 Pyruvate metabolism
    ANT_14270 (pdhB)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ANT_14270 (pdhB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-ProteinID: BAJ63455
UniProt: E8N4U1
Position
1591095..1592072
AA seq 325 aa
MARITMREAISQALWEEMERDPNVFILGEEVGVWGGTYAVTKGFYDHFGPERVRDTPIAE
AGIIGAAIGAALTGLRPVAELMTINFAFSAMDHIVNQAAKLHYMFGGQMVLPMVIRAVGG
GGRQLGATHSQTPDAVFAHFPGLKVVAPGTPADAKGLLKAAIRSNDPILFIEHATLYQMR
GEVPEGDYTVPIGKSTIQRPGRDVTIVTYSKMLEISLKAADQLAKEGIEVEIVDLRTLRP
LDMEPVLESFKKTNRAVIVEEGWKSYGVGAEIASRIYEEAFDYVDAPIRRVAQKEVPLPY
NRTLEQMALPKVEDVIQAVKEVLNG
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcacgaataaccatgcgtgaagcaatttctcaggctttatgggaagaaatggagcgt
gatcccaatgtcttcattcttggtgaagaggttggggtttggggtggaacctatgcggtg
acaaaaggtttttacgaccattttggtcctgaacgggttagagatacacccattgcagag
gcgggaatcatcggggctgcgattggtgctgcgctgactggtttgcgtcctgttgctgaa
ctgatgaccattaattttgctttttctgcgatggatcacattgtcaaccaggcggctaaa
ctccactacatgtttgggggacaaatggttttgcccatggtgatacgcgctgtaggcggg
ggggggcgtcagttgggagccactcactctcaaacccccgatgcagtgtttgcgcatttc
cctggtttgaaagtggttgctccaggcacaccggccgatgccaaaggtttacttaaagcc
gctattcgcagcaatgatcctatccttttcattgagcatgccaccttgtatcaaatgcgg
ggagaagttccggaaggcgattacaccgtaccgattggaaaatctaccattcagcgccct
ggaagagatgtcaccattgtaacctacagtaaaatgcttgagatctcgcttaaagccgct
gatcaactggcaaaagagggcattgaggtggagattgttgatctgcgcactctccgtcct
ctggatatggaaccggtgcttgaatccttcaagaagacgaatcgtgccgtcattgtggaa
gaggggtggaagtcctatggggtaggcgctgaaattgcctcccgcatttatgaggaagcc
ttcgattacgtggatgctccgattcgccgtgtggcgcaaaaagaagttcctttgccctat
aaccgtacgctggaacaaatggcactgccaaaggtcgaggatgtcattcaagcggtcaag
gaggtgctgaatggctga

DBGET integrated database retrieval system