KEGG   Anaerolinea thermophila: ANT_14280
Entry
ANT_14280         CDS       T01410                                 

Gene name
pdhC
Definition
(GenBank) putative pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_14280 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ANT_14280 (pdhC)
   00620 Pyruvate metabolism
    ANT_14280 (pdhC)
Enzymes [BR:atm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ANT_14280 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H HlyD_D23 QRPTase_N TetR_C_2
Other DBs
NCBI-ProteinID: BAJ63456
UniProt: E8N4U2
Position
1592065..1593348
AA seq 427 aa
MAETIKMPKLGFDMQEGTLVRWVRQEGEAVEKGQVLAEIETDKATVEVEASVSGIVHRHL
VEQGAVVPVGTPIAIIAAPGETVAEEPVAGVLPAKNVEEAAEKEAVSLAQPSVSGEEQRI
KASPLAKRLAKEHQVDLNAVQGSGPGGRIVRKDIEAYLAMIRTAVPQAVEVPIPTPSVST
SPAPSSGFTLPVWTAPESVPADETVPMDRLRQAIGRRMVDSKQNYPHFYITRSFNVEALM
ALREQINQVMPEGQKLTLNDFVIKAVALALRSYPNLNASISGNAILRHGRVNIGVAVAVE
GGLLTVVCKDADQKPLRVISSEIRDMVSRARQGKVRPEDIEGSTFSISNLGMFDVENFMA
IINPPESGILAVGAAQKVPVVVGDEIKTGLRMKATLSADHRVTDGAEAAQFMQVLARYLE
NPILLLV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctgagaccattaagatgcccaaattgggctttgacatgcaggaagggacactggtt
cgttgggtcaggcaagaaggcgaagccgttgaaaaaggacaggtgctggcagaaattgaa
acagataaggcaactgtcgaggttgaagccagtgtgagcggaattgttcatcgtcatctg
gtagagcaaggggctgttgttccggttgggacgcctattgccattattgcggcccccggc
gaaacggttgccgaagagccggtggcaggtgttttgcctgctaaaaatgtagaggaagcg
gctgaaaaagaagccgtttctctggcacagccatctgtcagtggtgaagagcaacgcatc
aaagcctcgcctttagccaagcgtctggcaaaagagcatcaggtggacttgaacgcggtg
cagggaagtggccctggtgggagaattgtgcgtaaagatatcgaagcctacctggcaatg
ataagaacggcggtgccccaggctgtggaggtaccgattccgactccctctgtgtctaca
tcaccagccccttcctcaggttttactctaccggtatggactgccccggagagcgttcca
gcggatgagactgttcccatggatcggttgcgccaggcgattgggcgtcgtatggtggat
tcaaagcagaactacccgcatttttatattactcgttcgttcaatgttgaagccctgatg
gctttgcgagagcaaattaatcaggttatgccagaagggcaaaaattaacgctgaacgat
tttgtgatcaaggcggttgcattggctttgagaagttatcctaacctgaacgcttcgatt
tccgggaatgccattctccgacatggacgcgtgaatattggggtggcagtggccgtagag
ggtggtttgctcactgtggtatgtaaagatgcggaccagaagccattgagagtcatttct
tcagaaattcgggatatggtttctcgtgccagacagggaaaagtacgccctgaggatatt
gagggctcgactttttctatcagcaaccttggcatgttcgatgtcgaaaactttatggcg
attattaatcccccagaaagtggtattcttgcagtgggagcggctcaaaaagtgccggtt
gtggttggcgacgaaattaaaaccggtctccggatgaaagctaccctttcggcagatcat
cgcgtgaccgacggtgctgaagccgcgcagttcatgcaggtactggctcgttatctggaa
aatcctatcttgcttctggtttag

DBGET integrated database retrieval system