KEGG   Anaerolinea thermophila: ANT_14330Help
Entry
ANT_14330         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
  KO
K07042  probable rRNA maturation factor
Organism
atm  Anaerolinea thermophila
Brite
KEGG Orthology (KO) [BR:atm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:atm03009]
    ANT_14330
Ribosome biogenesis [BR:atm03009]
 Prokaryotic Type
  Other maturation factors
   ANT_14330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0054 Peptidase_M10
Motif
Other DBs
NCBI-ProteinID: BAJ63461
NITE: ANT_14330
UniProt: E8N4U7
Position
complement(1597872..1598324)
Genome map
AA seq 150 aa AA seqDB search
MIYFFVDEAYEALVRKEPLIRAAEETLRVENHSDSDVTISIQNDEALKSLNAQFMGTEAP
TDVLSFTMDFFDPETERQYLGDILISYERAEEQAQTAGHSTENELILLIVHGILHLVGYD
HGTEEEKSKMWKTQSEILKQLGCEIKRLPE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgatttatttttttgttgatgaggcctatgaagcattagtacgcaaggaacctctaatc
cgcgctgcagaagagacacttcgcgttgaaaatcacagcgattcggatgtcacgataagc
attcaaaatgacgaagccctcaaatccttaaatgctcaatttatgggcacagaggctcct
actgatgtgctttcctttacgatggactttttcgatcccgaaacagaacgacagtatctg
ggagatattctcatctcgtatgagcgagcagaggaacaagcccaaacagccgggcattcc
acagaaaacgagctcatccttctcattgtccacggcattcttcatctggtaggttatgac
catgggacagaggaagaaaagagtaaaatgtggaaaactcagagcgaaattctcaaacag
ttgggatgtgaaattaagcggcttccagaatga

DBGET integrated database retrieval system