KEGG   Anaerolinea thermophila: ANT_14410Help
Entry
ANT_14410         CDS       T01410                                 

Definition
(GenBank) F420-0:gamma-glutamyl ligase
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
atm  Anaerolinea thermophila
Pathway
atm00680  Methane metabolism
atm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ANT_14410
Enzymes [BR:atm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     ANT_14410
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     ANT_14410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase
Motif
Other DBs
NCBI-ProteinID: BAJ63469
NITE: ANT_14410
UniProt: E8N4V5
Position
1606205..1606972
Genome map
AA seq 255 aa AA seqDB search
MSLQVLPISGIPEIKTGDVLSEIILKALEENNLSLQDEDILVLAQKIVSKAEGRFVNLTT
VTPSAKAYEYAEITQKDPRFIELVLRESRSVLRCRLGTIIVEHRNGFVCANAGIDHSNVR
GPWGNSEDWVLLLPEDADSSARVIRDQVFQKTQKRIGVMIIDSHGRAWRMGTVGVAIGLA
GVPGLVDLRGKPDLYGYRLRITMIGAADELAAAASLVMGQADEGTPVVLVRGFPYPLRES
SIQELIRPKELDLFR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcttcaagttctccctatttcgggaatccctgaaattaagacaggcgatgttctc
agtgaaatcattctgaaagcgctggaagaaaacaacctctctttacaggatgaggatatt
ctggtcctcgcacaaaaaattgtatcaaaagcagaggggagatttgtgaacttgaccacc
gttaccccttctgcaaaagcgtacgaatacgctgagattacacagaaagacccgcgtttc
atagaactggttttacgggaaagccgctcggtattgcgttgccgcctgggcaccatcatc
gtggagcatcgcaatggctttgtgtgtgccaatgcggggattgatcactccaacgtgcga
ggtccctggggtaattcggaagattgggtgcttctcttgcctgaagatgccgattcttct
gctcgagttatccgcgatcaggttttccagaagacgcagaagagaattggggtgatgatt
atcgattctcatggacgggcatggaggatgggaacggttggggtagccattgggctggcg
ggtgtccctggtttggtagatttgcgcggtaaaccggacctgtacggctatcgcttaaga
atcaccatgattggggcggcggatgaactggcagcagcggcttctctggtcatggggcaa
gccgatgaaggtacgcctgtagttctggttagagggtttccttatccgttgagggagtcc
tccatccaggagttaattcgacccaaagaattggatttattcaggtaa

DBGET integrated database retrieval system