KEGG   Anaerolinea thermophila: ANT_14520Help
Entry
ANT_14520         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
  KO
K07402  xanthine dehydrogenase accessory factor
Organism
atm  Anaerolinea thermophila
Brite
KEGG Orthology (KO) [BR:atm00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ANT_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAJ63480
NITE: ANT_14520
UniProt: E8N4W6
Position
1618762..1619610
Genome map
AA seq 282 aa AA seqDB search
MNWKRKVRRERLKQGLWAIVRGGGDLASGAILRLARAGIKVIVTELAQPLMVRRKVSFAE
AIYQGEVEIEGLRGVKAEIDVEQIIRIASEYQIPVIADPELKIQSLFTPDILVDGRMLKK
SLEDQRTLASLVIGLGPGFVAGKNCHAVIETKRGHFLGRVIWEGEPEKDSGIPEGVDGKF
GERVLRAPSEGEFMAGVEIGESVLSGQCLGYVNGVPVYAPFDGVVRGLIWSGLHVMQGQK
IGDIDPRGDPRYCWLVSDKSLAVGGGVLEAVLTIPEFRARLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaactggaagaggaaagtgaggcgtgaacgcttgaaacaagggttatgggcaattgtt
cgtggtggtggtgatttagccagtggtgcaatacttcgattagcgcgagcgggaataaaa
gttatcgtcacagaactggcacaacccttaatggtgcggcgcaaggtttcgtttgctgaa
gcaatttatcaaggagaagtagaaattgagggccttcgaggggttaaggctgagattgat
gttgaacaaataattcgtatagccagcgaataccaaatcccggtgattgccgatccagaa
cttaagatccaaagcctcttcaccccggatattcttgtagatggcaggatgttgaagaaa
agtttagaggatcaacgcactcttgcttctcttgtgattgggttgggacctggctttgtg
gcgggaaaaaactgccatgcagtgattgagaccaagcgtggacattttctcggtagggtg
atttgggaaggagagcccgaaaaggactctgggataccggaaggcgtggatgggaagttt
ggcgaaagggtgttacgtgccccttctgagggagaatttatggcaggggttgaaattgga
gagagcgttctctcgggtcaatgcctgggctatgtcaatggggtgcctgtatatgcaccg
tttgatggagtggttcgcgggctgatatggtcaggacttcatgtgatgcaggggcaaaag
attggagatattgatccaagaggcgatccacgttattgctggttggtgtccgataagtcc
ttagcggtgggcggaggtgtcttggaggcagtcttaactattccggagtttcgagcgcgg
ttgggataa

DBGET integrated database retrieval system