KEGG   Anaerolinea thermophila: ANT_14590
Entry
ANT_14590         CDS       T01410                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_14590 (pckA)
   00020 Citrate cycle (TCA cycle)
    ANT_14590 (pckA)
   00620 Pyruvate metabolism
    ANT_14590 (pckA)
Enzymes [BR:atm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ANT_14590 (pckA)
SSDB
Motif
Pfam: PEPCK_ATP AAA_33
Other DBs
NCBI-ProteinID: BAJ63487
UniProt: E8N4X3
Position
complement(1625903..1627531)
AA seq 542 aa
MIYTGIPGDYSLELHGLQNLRTAYWNLPPAGLIEQSILRGESILSRTGAVVVNTGKHTGR
SPSDKFIVRHPSIENQIWWGKVNQPLAPEKFERLLAKARAYLQGKDVFIQDLQAGAHPSF
ALPIRLITEKAWAALFAYNLFLRLPHDQLVHHRPEFTIFHLPEFLASPEEDGTRSETVIA
LDLKKKVILIAGTSYAGEIKKSIFTVLNYLLPQKGVLSMHCSANIGQEQDVALFFGLSGT
GKTTLSSDPERRLIGDDEHGWADDGIFNFEGGCYAKTIHLRPELEPLIWQATQSFGAVLE
NVTIDTISRELDFDDDHRTENTRGAYPLHYIPNFVPEGRGGHPKNIFFLSADAFGVLPPI
ALLSPEQAMYYFLSGYTSKLAGTETGLGTEPQATFSTCFGAPFLPLHPHEYAHLLGEKIQ
RHQARVWLVNTGWTGGPYGVGQRIRLPYTRALIRAALHGDLEHVEYQIEPHFGLSIPLEC
PGVPSEILNPRQTWADPEAYEQQASLLVEQFNKNFEPFVQEVSPEVVLAGPGRKDLRPQK
LG
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgatttacacaggtatcccaggagattacagtctggagttgcacggtttgcaaaacctt
cgtacagcctattggaatctgccccctgcaggtctcatcgaacaatccatcttgcgagga
gaaagcatcctttcccgaacaggcgctgtggttgtaaatacaggaaaacataccgggcgt
tctcccagtgacaaattcatcgtaagacaccccagcatcgagaatcagatttggtgggga
aaagtcaatcaacctcttgcgccagaaaaattcgaacgcttactcgccaaagcaagagcc
tacctgcagggaaaagatgtctttattcaggacttacaagcaggagcacatccatcattt
gcgctgcccattcggttgattacggaaaaagcatgggcggctttgtttgcctataacctg
tttttgcgacttcctcatgatcaactggtccatcaccgccctgaatttaccatatttcat
ttgcccgaatttcttgcctctccggaggaggatggaacccgctctgaaacagttattgca
ctggatttaaagaaaaaagtcattctgattgcaggcaccagttatgccggagagattaag
aagtccatttttaccgtattaaattacctcttaccccaaaaaggggttctctccatgcat
tgctctgccaatattgggcaagaacaagatgtagcgttgttttttgggctgtctggaacg
ggcaaaacgaccctgtcttcagatcctgaacgtcgtctgataggagacgatgagcatggc
tgggctgatgatggaatcttcaattttgaaggaggatgttacgccaaaaccatccatcta
cgtcccgagttagaacccttgatctggcaggcaacccaaagttttggggcagttcttgaa
aatgtaaccatagacaccattagccgcgaattggatttcgacgacgatcatcgcacagaa
aatactcgaggggcataccctctgcactacattcctaactttgttcccgaaggcagagga
ggtcacccgaaaaatatctttttcttatctgctgacgcttttggggtattgcctccgatt
gccctcctaagccccgaacaagccatgtattacttcctctcaggatacacttcaaaactt
gcaggtactgaaaccggtttggggactgaacctcaagccaccttctcaacctgtttcggt
gcacctttcctgcctttacatcctcatgaatatgctcatctgttaggtgaaaaaattcag
cggcaccaggcaagggtatggttagtgaatacaggctggacaggcgggccttacggagtt
ggtcaacgcattcgcctgccttataccagagccctcatccgcgctgccctccatggggat
ctggaacatgtggagtatcagatcgaacctcatttcggattaagcattcctctggaatgc
ccaggagttcccagtgagattctcaacccacgtcaaacctgggcagatccagaggcatat
gagcagcaagcctctcttctggttgaacaattcaataaaaactttgagccatttgttcag
gaagtctcaccagaagtagtgcttgctgggcccggaagaaaagatttgagaccgcagaaa
ctgggttaa

DBGET integrated database retrieval system